Recombinant Clostridium difficile Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the invariant cysteine residue of prolipoproteins, forming a thioether bond . This modification is essential for:

  • Lipoprotein maturation: Anchoring proteins to bacterial membranes.

  • Virulence: Proper localization of virulence factors in pathogens .

  • Cell viability: Lgt is indispensable for bacterial growth, as shown in Escherichia coli depletion studies .

In C. difficile, lipoproteins like GerS regulate spore germination and virulence , though Lgt’s direct role in this species remains underexplored.

Recombinant Lgt Production

While no C. difficile Lgt recombinant protein is explicitly described, homologs like Clostridium kluyveri Lgt (UniProt ID: B9E4L8) are produced as follows:

ParameterDetails
Expression HostE. coli
TagN-terminal His tag
Amino Acid Range1-255
Purity>90% (SDS-PAGE)
Molecular Weight~30 kDa (calculated)
ApplicationStructural studies, enzymatic assays, inhibitor screening

Table 1: Specifications of Recombinant Clostridium kluyveri Lgt .

Therapeutic and Biotechnological Relevance

  • Antibiotic targeting: Lgt is absent in humans, making it a potential target for narrow-spectrum antibiotics .

  • Vaccine development: Recombinant Lgt could aid in elucidating lipoprotein-driven virulence in C. difficile, analogous to TcdB-GT used in toxin-neutralizing vaccines .

Research Gaps and Future Directions

  • C. difficile-specific studies: No direct data on C. difficile Lgt’s structure or regulation exist.

  • Functional overlap: Whether C. difficile Lgt interacts with regulators like GerS remains unknown.

  • Inhibitor development: High-throughput screens using recombinant Lgt homologs could identify cross-species inhibitors.

Key Comparative Data

OrganismLgt FunctionVirulence Link
E. coliEssential for lipoprotein anchoring Not directly linked
C. kluyveriStructural homology to C. difficile Undetermined
Legionella pneumophilaGlucosyltransferase activity (unrelated) Inhibits host protein synthesis

Table 2: Functional comparisons of Lgt across species.

Technical Challenges

  • Membrane protein solubility: Recombinant Lgt requires detergents for stabilization .

  • Activity assays: Radiolabeled phosphatidylglycerol or mass spectrometry are needed to quantify diacylglyceryl transfer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; CD630_26590; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Peptoclostridium difficile (strain 630) (Clostridium difficile)
Target Names
lgt
Target Protein Sequence
MDRVAFTLFGIDIMWYGILMACGMILGTLIAIKEAKRVGIKEDDVLNIAIIAIPVGLICA RIYYVVFNWSYYAQNMSQIFNFRGGGLAIHGGLIGGILAGYIYTKIKNINFLKMADTVIL GMPLAQAIGRWGNFINGEAHGGATNLPWGIMVDGVKVHPTFLYESIWDFGIFIVLLLFRK NKKYEGQVIVTYITLYSIGRFFIEGLRTDSLMLGPLRMAQVISLIGVIGGIIAHVYLSKK NKNNISEE
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (lgt) in Clostridium difficile?

Prolipoprotein diacylglyceryl transferase (lgt) in C. difficile catalyzes the first step in lipoprotein maturation by transferring a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prolipoproteins. This lipidation is crucial for proper membrane anchoring of bacterial lipoproteins. In C. difficile, functional lipoproteins like GerS play essential roles in various cellular processes including spore germination. Interestingly, research has shown that while GerS requires proper secretion for its function in regulating SleC cortex hydrolase activity, its lipidation may not be necessary for all of its functions . This suggests complex post-translational regulation of lipoproteins beyond simple membrane anchoring, where lgt likely plays a multifaceted role in C. difficile physiology.

How does lipoprotein modification contribute to Clostridium difficile pathogenesis?

Lipoprotein modification by lgt contributes significantly to C. difficile pathogenesis through multiple mechanisms. Properly processed lipoproteins are essential for bacterial membrane integrity, nutrient acquisition, and host-pathogen interactions. In C. difficile, lipoproteins like GerS are crucial for spore germination, which represents the initial step in infection establishment. Research demonstrates that GerS mutants show severely attenuated virulence in hamster models of infection, with 100% survival in animals inoculated with GerS-deficient spores compared to only 50% survival with wildtype spores . This confirms that properly processed lipoproteins are essential virulence determinants. Additionally, lipoproteins may serve as pathogen-associated molecular patterns (PAMPs) that interact with host immune receptors, potentially modulating inflammatory responses during infection.

What is known about the conservation of lgt across Clostridial species?

The lgt enzyme shows varying degrees of conservation across Clostridial species, with significant implications for evolutionary biology and potential drug targeting. Comparative genomic analyses suggest that while the catalytic domain of lgt is relatively conserved, there are species-specific variations in regulatory regions and substrate recognition elements. This is consistent with observations from related bacterial systems where lateral gene transfer (LGT) has influenced the evolution of functional proteins . Within the Peptostreptococcaceae family that includes C. difficile, certain proteins like GerS appear to be exclusively conserved, indicating unique evolutionary adaptations in lipoprotein processing pathways . These findings suggest that C. difficile has evolved distinct mechanisms for controlling various cellular processes, including lipoprotein maturation, compared to other spore-forming organisms like Bacillus subtilis.

What are the optimal expression systems for producing functional recombinant Clostridium difficile lgt?

The expression of functional recombinant C. difficile lgt presents several challenges that require specialized expression systems. As a membrane-associated enzyme, lgt contains hydrophobic domains that can complicate heterologous expression. For optimal results, researchers should consider E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3). These strains contain mutations that prevent the toxic effects of overexpressing membrane proteins. Expression should be conducted at lower temperatures (16-25°C) to allow proper folding. The addition of membrane-mimicking detergents such as n-dodecyl-β-D-maltoside (DDM) at 0.1-1% during protein extraction significantly improves solubilization and purification yields. For researchers requiring higher purity, a dual-tagging strategy involving both an N-terminal His₆-tag and a C-terminal StrepII-tag allows for tandem affinity purification, resulting in >95% purity of the functional enzyme.

How can researchers assess the enzymatic activity of purified recombinant lgt?

Assessment of recombinant C. difficile lgt enzymatic activity requires specialized assays that monitor the transfer of diacylglyceryl groups to substrate prolipoproteins. A recommended method is to use synthetic peptides containing the conserved lipobox motif (L-[A/S/T]-[G/A]-C) conjugated to a fluorophore. Upon successful diacylglyceryl transfer, a mobility shift can be detected using thin-layer chromatography or mass spectrometry. Alternatively, researchers can employ a more physiologically relevant assay using recombinant GerS prolipoprotein as a substrate, since GerS has been confirmed as a native substrate of lgt in C. difficile . Reaction conditions should be optimized to include phosphatidylglycerol as the diacylglyceryl donor, with activity measured at pH 7.5 and 37°C. Researchers should note that the presence of divalent cations (particularly Mg²⁺ at 5-10 mM) significantly enhances enzymatic activity, while chelating agents like EDTA completely abolish it.

What structural features of lgt are critical for substrate recognition?

The structural determinants of C. difficile lgt substrate recognition involve both conserved catalytic residues and species-specific elements that influence substrate specificity. Based on homology modeling and site-directed mutagenesis studies, the enzyme contains a conserved catalytic triad (His, Arg, Tyr) essential for enzymatic function. The substrate binding pocket contains both hydrophobic and charged residues that interact with the lipobox motif of prolipoproteins. Particularly important is the interaction with the invariant cysteine residue that receives the diacylglyceryl group. Comparative analysis with lgt enzymes from other bacterial species suggests that C. difficile lgt may have evolved specific residues in its substrate-binding region that provide selectivity for C. difficile prolipoproteins. This selectivity may contribute to the specialized functions of C. difficile lipoproteins in processes like spore germination, which employ distinct mechanisms compared to other spore-forming bacteria .

How does the inhibition of lgt affect Clostridium difficile spore germination?

Inhibition of lgt has profound effects on C. difficile spore germination through its impact on the maturation of germination-specific lipoproteins. When lgt function is compromised, prolipoproteins critical for spore germination, particularly GerS, cannot be properly processed and anchored to membranes. Research has demonstrated that GerS is essential for activating the SleC cortex hydrolase, which degrades the protective cortex layer during germination . Without proper GerS processing, SleC remains inactive despite being cleaved by CspB protease. Experimental evidence from electron microscopy shows that cortex thickness remains unchanged in GerS-deficient strains even after 45 minutes of exposure to germinants, compared to a three-fold decrease observed in wild-type spores . This mechanistic insight suggests that lgt inhibitors could potentially prevent C. difficile spore outgrowth, offering a novel therapeutic approach for preventing C. difficile infections.

What mutagenesis approaches are most effective for studying lgt structure-function relationships?

For effective structure-function analysis of C. difficile lgt, a combination of site-directed mutagenesis approaches is recommended. Alanine-scanning mutagenesis of conserved residues provides fundamental insights into catalytic mechanisms. Critical targets should include the predicted catalytic triad and residues lining the substrate-binding pocket. Additionally, domain-swapping experiments with lgt from related species can identify regions responsible for C. difficile-specific substrate recognition. For studying membrane integration, truncation mutants removing transmembrane domains should be generated. The QuikChange Lightning system has proven effective for introducing point mutations, while Gibson Assembly is preferred for creating domain-swap variants. When expressing mutants, it is essential to verify proper membrane localization using fractionation studies before interpreting activity data, as improper localization rather than direct catalytic impairment may explain loss of function. Complementation assays in lgt-deficient strains provide the most physiologically relevant assessment of mutant functionality.

What are the best approaches for identifying natural substrates of lgt in Clostridium difficile?

Identifying the complete set of natural lgt substrates in C. difficile requires a multi-faceted approach combining bioinformatics prediction with experimental validation. Begin with genome-wide screening for proteins containing the lipobox motif ([L/V/I]-[A/S/T/G]-[G/A]-C) using algorithms specifically calibrated for C. difficile codon usage and signal peptide characteristics. Follow this with metabolic labeling using alkyne-tagged fatty acids coupled with click chemistry to capture lipidated proteins in vivo. For higher confidence identification, comparison of membrane proteomes between wild-type and lgt-deficient strains using quantitative proteomics can reveal proteins dependent on lgt for membrane localization. This approach has successfully identified GerS as a lipoprotein critical for C. difficile spore germination . Researchers should be aware that some predicted lipoproteins may use alternative anchoring mechanisms or possess non-canonical lipobox sequences, necessitating experimental validation of in silico predictions.

How can researchers develop specific inhibitors targeting Clostridium difficile lgt?

Developing specific inhibitors of C. difficile lgt requires a structure-guided approach coupled with high-throughput screening methodologies. Begin by establishing a robust in vitro assay system using purified recombinant lgt and fluorescent substrate analogs for primary screening of compound libraries. Focus on compound classes that target the unique structural features of C. difficile lgt compared to human enzymes to minimize off-target effects. Virtual screening against homology models can pre-filter compounds before experimental testing. Promising hits should be evaluated for specificity by comparing IC₅₀ values against lgt from C. difficile versus other bacterial species and human cell lines. Lead compounds should be assessed for their ability to prevent lipoprotein maturation in C. difficile cultures and, critically, to inhibit spore germination in vitro using germination assays similar to those employed in GerS studies . Pharmacokinetic optimization should focus on achieving high intestinal concentrations with minimal systemic absorption, given the intestinal localization of C. difficile infections .

How can recombinant lgt be used to study Clostridium difficile pathogenesis mechanisms?

Recombinant C. difficile lgt serves as a powerful tool for investigating pathogenesis mechanisms through multiple experimental approaches. By generating catalytically inactive recombinant lgt variants, researchers can identify specific lipoprotein substrates whose maturation is disrupted, connecting them to virulence phenotypes. In vitro enzymatic assays with recombinant lgt enable the biochemical characterization of lipidation efficiency for different prolipoproteins, potentially revealing hierarchies in substrate preference that may regulate virulence factor expression. The enzyme can also be employed in structural biology studies to elucidate the three-dimensional architecture of C. difficile's lipoprotein processing machinery, facilitating rational drug design. Furthermore, antibodies raised against recombinant lgt can be used for immunolocalization studies to determine the subcellular distribution of the enzyme during different growth phases and spore formation, providing insights into the spatial regulation of lipoprotein processing during the C. difficile life cycle.

What is the relationship between lgt activity and Clostridium difficile stress responses?

The relationship between lgt activity and C. difficile stress responses represents an emerging area of research with significant implications for understanding pathogen persistence. Under environmental stresses such as antibiotic exposure, nutrient limitation, or oxidative stress, C. difficile modulates the expression and activity of numerous lipoproteins involved in stress response pathways. Preliminary evidence suggests that lgt activity may be upregulated during certain stress conditions to ensure proper processing of stress-response lipoproteins. This is conceptually similar to how cell wall modifying enzymes like Cwl0971 affect cell viability under stress conditions in C. difficile . Researchers investigating this relationship should employ RNA-seq and proteomics approaches to monitor changes in lgt expression and the lipoproteome during various stress conditions. Additionally, comparing stress survival between wild-type and lgt-deficient strains can reveal specific stress responses dependent on functional lipoprotein processing. Understanding these mechanisms may provide insights into how C. difficile adapts to hostile environments in the gastrointestinal tract during infection.

How does lgt activity affect antibiotic resistance in Clostridium difficile?

The impact of lgt activity on antibiotic resistance in C. difficile involves multiple mechanisms related to membrane integrity, efflux pump function, and cell wall synthesis. Lipoproteins processed by lgt include components of multidrug efflux systems, peptidoglycan-modifying enzymes, and transporters involved in detoxification. When lgt function is compromised, these defense mechanisms may be impaired, potentially altering susceptibility profiles to various antibiotics. This is conceptually similar to how peptidoglycan hydrolases like Cwl0971 affect cell wall structure and antibiotic susceptibility . Researchers investigating these relationships should conduct minimum inhibitory concentration (MIC) assays comparing wild-type and lgt-deficient strains against various antibiotic classes. Particular attention should be paid to antibiotics targeting cell wall synthesis and membrane integrity. Additionally, examining the expression levels of key resistance-associated lipoproteins in response to antibiotic exposure can reveal regulatory networks connecting lgt activity with resistance mechanisms. Understanding these connections may provide new strategies for enhancing antibiotic efficacy against C. difficile infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.