Recombinant Clostridium difficile Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP2; bacA2; upk2; CD630_29860; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Peptoclostridium difficile (strain 630) (Clostridium difficile)
Target Names
uppP2
Target Protein Sequence
MMSLDVIFILKSVIIAIVEGLTEFIPVSSTGHMILVGNLIDFKGQFAEMFEVVIQLGAIL AVVVLYWKKIKDSVIEFFKFIFTGGKEGKIGFRFGMNVIIGCIPFAIIGVLFYDNIKSLF NLQSVIIGFIVGGILLLVVETLFRKKNHSTDNIDKITPIQALKVGTLQVLSAWPGMSRSA STIMGGWIAGLNSPTAAEFSFFLAVPAMVASSGKDLFEFDYSIMTPTLWIALVVGFIVAF IVSIIVMEKFVNFLKKKPMRVFAVYRIIMGVVLAVLAFTNIISV
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 2 (uppP2) and what role does it play in C. difficile?

Undecaprenyl-diphosphatase 2 (uppP2) belongs to the essential class of UPP phosphatases that catalyze the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This enzymatic reaction is crucial for the lipid II cycle in bacterial cell wall biosynthesis. In C. difficile, as in other bacteria, this process is essential for recycling the lipid carrier molecule, enabling continuous cell wall synthesis and structural integrity. UPP phosphatases connect cell wall synthesis to membrane homeostasis by controlling the availability of the lipid carrier undecaprenyl phosphate .

How does uppP2 contribute to the lipid II cycle in bacterial cell wall synthesis?

UPP phosphatases like uppP2 serve a critical function in the lipid II cycle by regenerating UP from UPP. The cycle proceeds as follows: UP is loaded with UDP-MurNAc-pentapeptide on the cytoplasmic side of the membrane, followed by addition of an N-acetylglucosamine (GlcNAc) molecule to form lipid II. This building block is then shuttled across the membrane by flippases Amj and MurJ. On the outside, it is incorporated into the existing cell wall through transglycosylation and transpeptidation reactions, releasing UPP. UPP phosphatases like uppP2 then dephosphorylate UPP to UP, which is flipped back to the cytoplasmic side to begin the cycle again .

Why is uppP2 considered important for antimicrobial research?

The lipid II cycle represents a critical bottleneck in bacterial cell wall synthesis, with UP availability as the central limiting factor. Each bacterial cell contains only approximately 2×10^5 UP molecules (representing just 0.5-1% of all phospholipids), and each carrier shuttles 1-3 cell wall building blocks per second during exponential growth . This scarcity makes the cycle particularly vulnerable to disruption. Antibiotics targeting any step in this cycle benefit from this bottleneck effect, as blocking one process leads to accumulation of intermediates, shortage of free carrier molecules, and impaired cell wall biosynthesis . As an enzyme involved in this critical pathway, uppP2 represents a potential target for novel antimicrobials against C. difficile.

What is the recommended approach for designing experiments to study uppP2 function?

When designing experiments to study uppP2 function, researchers should follow a systematic approach aligned with established scientific methodology. Begin by clearly identifying the specific research question or problem regarding uppP2 in a single sentence . Next, formulate a testable hypothesis based on previous knowledge and scientific evidence, clearly identifying the independent and dependent variables . Design experiments with appropriate controls to test this hypothesis, listing all required materials and safety considerations .

For uppP2 studies, crucial elements include:

  • Controls for enzyme activity (heat-inactivated enzyme, known inhibitors)

  • Careful pH and buffer optimization for membrane enzyme assays

  • Multiple experimental repeats to ensure reproducibility

  • Clear definition of how data will be collected and recorded

  • Pre-designed data tables with appropriate units

What expression systems are most effective for producing recombinant C. difficile uppP2?

For recombinant expression of membrane proteins like uppP2, several systems warrant consideration:

Expression SystemAdvantagesDisadvantagesOptimization Parameters
E. coli BL21(DE3)High yield, easy handling, economicalMay form inclusion bodiesLower temperature (16-20°C), reduced inducer concentration
C43(DE3) or C41(DE3)Specialized for membrane proteinsLower yields than standard BL21Induction timing, media composition
Cell-free systemsAvoids toxicity issues, rapid productionExpensive, smaller scaleDetergent/lipid composition, reaction time
Insect cell systemsBetter protein folding for complex proteinsTime-consuming, costlyVirus titer, harvest timing, cell density

Regardless of system choice, optimize expression by testing multiple construct designs with various purification tags (His6, MBP, GST) positioned at either the N- or C-terminus. Following expression, purification typically involves membrane isolation, detergent solubilization, and chromatographic separation using methods designed to maintain enzyme activity throughout the process.

What analytical methods can quantify uppP2 enzymatic activity?

Several complementary approaches can assess uppP2 activity with varying degrees of sensitivity and throughput:

All these methods require careful experimental design with appropriate controls and optimized reaction conditions, following scientific methodology principles for reproducible results .

How should researchers analyze potential contradictions in uppP2 functional data?

When confronting contradictory data regarding uppP2 function, researchers should implement a structured analytical approach:

  • Verify experimental conditions: Systematically compare all experimental parameters (pH, temperature, buffer composition, enzyme concentration, substrate preparation) to identify potentially confounding variables.

  • Evaluate protein quality: Assess protein purity, stability, and activity using multiple orthogonal methods. Different purification approaches may yield protein with varying degrees of native activity.

  • Consider physiological context: In vitro conditions may not accurately reflect the complex membrane environment where uppP2 naturally functions. Contradictions may arise from differences between artificial and native conditions.

  • Apply multiple analytical methods: No single technique provides complete characterization. Employ complementary approaches (biochemical, biophysical, genetic) to build a coherent understanding.

  • Statistical rigor: Apply appropriate statistical analysis to determine if apparent contradictions represent significant differences or fall within expected experimental variation .

When presenting contradictory results, organize data in comparative tables and use structured experimental design principles to systematically address each contradiction.

What statistical approaches are most appropriate for analyzing uppP2 kinetic data?

Analysis TypeStatistical MethodApplication to uppP2 ResearchRequirements
Enzyme kineticsNon-linear regressionDetermination of Km, Vmax, kcat valuesMultiple substrate concentrations, initial velocity conditions
Inhibition studiesLinear regression (Lineweaver-Burk, Dixon plots)Inhibitor characterization (competitive, non-competitive)Multiple inhibitor concentrations with varied substrate levels
Comparative analysisANOVA with post-hoc testsComparing uppP2 variants or conditionsNormality of data, multiple replicates
Stability studiesExponential decay modelsThermal or chemical stability quantificationTime-course measurements under varying conditions

How can researchers elucidate the structure-function relationship of uppP2?

Investigating structure-function relationships in uppP2 requires a multifaceted approach combining:

  • Sequence analysis and homology modeling: Begin by aligning uppP2 with characterized UPP phosphatases to identify conserved motifs and predict functional domains. Homology modeling based on related structures provides initial structural insights.

  • Site-directed mutagenesis: Design mutations targeting:

    • Predicted catalytic residues

    • Membrane-interaction domains

    • Potential regulatory sites
      Each mutant should be systematically characterized for expression, stability, and activity.

  • Structural determination techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly powerful for membrane proteins)

    • NMR spectroscopy for dynamic structural information

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Computational approaches:

    • Molecular dynamics simulations in membrane environments

    • Substrate docking studies

    • Molecular modeling of enzyme-substrate interactions

The experimental design should systematically address how specific structural elements contribute to substrate binding, catalytic activity, membrane association, and potential regulation, with carefully controlled variables and appropriate statistical analysis .

What methodologies can identify potential inhibitors of uppP2 for antimicrobial development?

Developing inhibitors against uppP2 requires a structured approach:

  • High-throughput screening (HTS): Design robust, miniaturized assays suitable for screening large compound libraries. Phosphate detection assays adapted to microplate format provide an efficient primary screening method.

  • Fragment-based screening: Identify small chemical fragments that bind to uppP2, which can be elaborated into more potent inhibitors using techniques like NMR, thermal shift assays, or crystallography.

  • Computational approaches:

    • Virtual screening against homology models or experimental structures

    • Pharmacophore modeling based on known inhibitors of related enzymes

    • Molecular dynamics simulations to identify binding hotspots

  • Rational design: If the protein structure is known, structure-based design can guide the development of compounds that interact with the catalytic site or allosteric regions.

  • Validation cascade:

Validation LevelTechniquesExpected Outcomes
Biochemical confirmationDose-response curves, mechanism of inhibition studiesIC50, Ki values, inhibition mechanism
Biophysical bindingSurface plasmon resonance, isothermal titration calorimetryBinding constants, thermodynamic parameters
Cellular activityC. difficile growth inhibition assaysMIC values, growth curve effects
Specificity profilingTesting against human phosphatases, other bacterial UPP phosphatasesSelectivity indices, toxicity prediction
Mode of actionLipid II cycle intermediate accumulation, cell wall analysisConfirmation of target engagement in vivo

Each step requires careful experimental design with appropriate controls and statistical analysis to ensure reliable results .

How does uppP2 function integrate with the broader C. difficile cell wall synthesis pathway?

The integration of uppP2 into the broader cell wall synthesis pathway represents a complex interaction network:

  • Coordination with peptidoglycan and wall teichoic acid (WTA) synthesis: UP is the carrier for both peptidoglycan and WTA building blocks, creating competition between these pathways. Under UP limitation, the relative amounts of WTA and peptidoglycan synthesis are reduced, especially if conditions favor the competing pathway .

  • Regulation within the lipid II cycle: The dephosphorylation of UPP to UP by uppP2 and other UPP phosphatases is critical for maintaining the carrier molecule pool. The cellular UP pool can be replenished through three mechanisms:

    • Recycling of UPP via UPP phosphatases like uppP2

    • De novo synthesis of UPP via UppS, followed by dephosphorylation

    • Phosphorylation of undecaprenol by kinases like DgkA (in Gram-positive bacteria)

  • Impact on antibiotic resistance: The lipid II cycle is targeted by various antibiotics. Alterations in uppP2 function could potentially affect susceptibility to these compounds by modifying the flux through the cycle.

Experimental approaches to study these interactions should include metabolic labeling of cell wall components, quantification of lipid II cycle intermediates, and systematic genetic manipulation of related pathway components, all designed according to rigorous experimental methodology .

How does uppP2 compare structurally and functionally to other UPP phosphatases?

While specific structural information about C. difficile uppP2 is limited in the available research, comparative analysis with other UPP phosphatases provides valuable insights:

UPP PhosphataseOrganismStructural FeaturesFunctional CharacteristicsRelevance to uppP2 Research
UppPB. subtilisIntegral membrane proteinForms essential pair with BcrC; neither can be deleted individuallySuggests potential functional redundancy for uppP2
BcrCB. subtilisMembrane-associatedDual function: UPP phosphatase and bacitracin resistanceIndicates potential secondary functions of uppP2
PgpBE. coliMultiple transmembrane domainsBroad substrate specificity (phosphatidylglycerol phosphate, UPP)Suggests investigation of uppP2 substrate range
YbjGE. coliMembrane proteinContributes to bacitracin resistancePoints to potential antibiotic resistance role

Understanding these relationships requires sequence alignment, phylogenetic analysis, and comparative biochemical characterization. Heterologous expression of uppP2 in UPP phosphatase-deficient strains of model organisms could elucidate functional conservation. Structural studies comparing uppP2 with characterized phosphatases would reveal conserved catalytic mechanisms and unique features that might be exploited for specific inhibitor development.

What genetic approaches can determine the essentiality of uppP2 in C. difficile?

Determining gene essentiality requires carefully designed genetic approaches:

  • Conditional expression systems:

    • Inducible promoters to control uppP2 expression

    • Depletion studies to observe phenotypic consequences

    • Quantitative correlation between expression level and growth phenotypes

  • Gene disruption strategies:

    • Insertional mutagenesis with markers

    • CRISPR-Cas9 genome editing (if established for C. difficile)

    • Antisense RNA approaches for partial knockdown

  • Complementation studies:

    • Expression of uppP2 from plasmid in conditional mutants

    • Heterologous complementation with other UPP phosphatases

    • Chimeric protein expression to identify essential domains

  • Synthetic lethality screening:

    • Identifying genetic interactions with other cell wall synthesis genes

    • Testing for functional redundancy with other potential UPP phosphatases in C. difficile

Each approach requires careful experimental design with appropriate controls, including validation of genetic manipulations and phenotypic characterization under varying conditions . The observation in B. subtilis that UPP phosphatases BcrC and UppP form an essential pair (where neither can be deleted individually but only as a pair) suggests that potential redundancy should be carefully examined in C. difficile .

Data Table: Essential Parameters for uppP2 Enzymatic Assays

ParameterRecommended RangeCritical ConsiderationsValidation Method
pH6.5-8.0Test narrow intervals (0.5 pH units)Activity profiling across pH range
Temperature25-37°CC. difficile optimal growth temperature: 37°CTemperature stability curves
Detergent0.01-0.1% (DDM, LDAO)Critical micelle concentration, enzyme stabilityActivity retention over time in various detergents
Divalent cationsMg²⁺, Mn²⁺ (0.5-5 mM)Potential cofactor requirementActivity with/without EDTA chelation
Substrate concentration10-100 μM UPPSolubility limitations in aqueous buffersKinetic parameter determination
Enzyme concentration0.1-1 μMLinear range of activityInitial velocity conditions verification
Reaction time5-30 minutesProduct inhibition considerationsTime course linearity validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.