Recombinant Clostridium kluyveri Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Enzymatic Context and Function

Cobalamin synthases like CobS are typically involved in the final steps of vitamin B₁₂ biosynthesis, facilitating the assembly of the corrin ring and nucleotide loop. While no direct studies on C. kluyveri CobS were identified in the provided sources, insights can be drawn from homologous systems:

  • CobQ in C. kluyveri: A recombinant cobQ protein (cobyric acid synthase) from C. kluyveri (strain NBRC 12016) has been produced in E. coli or yeast systems . This enzyme is implicated in modifying the corrin ring structure during cobalamin synthesis.

  • PduS in Salmonella: Although not from Clostridium, the PduS cobalamin reductase (FMN-dependent) from Salmonella enterica demonstrates functional parallels, reducing cobalt in cobalamin precursors (Co³⁺ → Co⁺) to enable adenosylation .

Recombinant Production and Applications

The recombinant cobQ protein from C. kluyveri exemplifies the technical feasibility of producing cobalamin-related enzymes for research:

ParameterDetails
Expression SystemE. coli, yeast, baculovirus, or mammalian cells
Protein FunctionCobyric acid synthase (modifies corrin intermediates in B₁₂ synthesis)
RelevanceVaccine development and metabolic engineering

Genomic and Metabolic Insights

Genomic analysis of C. kluyveri reveals unique metabolic capabilities, though cobalamin biosynthesis pathways remain partially characterized:

  • The genome lacks molybdopterin biosynthesis genes but encodes nitrogenases and electron transport proteins for anaerobic metabolism .

  • CoA Transferases: C. kluyveri expresses succinyl-CoA:CoA transferase (Cat1) and 4-hydroxybutyrate dehydrogenase (4hbD), which interact with cobalamin-dependent pathways in chain elongation .

Research Challenges and Gaps

  • CobS Specificity: The absence of direct references to C. kluyveri CobS suggests either nomenclature variations (e.g., cobQ vs. cobS) or incomplete pathway annotation in genomic studies .

  • Functional Redundancy: C. kluyveri may rely on alternative reductases or adenosyltransferases (e.g., PduO in Salmonella) for cobalamin recycling .

Future Directions

  • Heterologous Expression: Leveraging systems like E. coli to express C. kluyveri CobS could clarify its role in B₁₂ synthesis.

  • Structural Studies: Resolving the 3D structure of cobQ or homologous enzymes may elucidate substrate-binding mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
cobS; CKL_3341; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Target Names
cobS
Target Protein Sequence
MKELLNDFFLILQLLTRIPVNRNLLCRRENFRRGASFMPLVGVIVGGIQWIIYKLCIIIF SLNVSIVIVILAGIVLTGALHVDGLGDMCDGFFSFKEKGKIIEIMKDSRIGTYACLAIII DILLKYSFFCSIVPSFSLIIIIAPVMSRFSIVFIAFIGKPAKSTGSGNLFVENIGKWQLF WAAFITVITLFFLMNMNFIYVIILIFAGLFMSFLFNVFCNRKAGGLTGDLLGANNEIVEI LTMVMLCVIITK
Uniprot No.

Target Background

Function
This protein catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to produce adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of cobS in C. kluyveri's cobalamin biosynthesis pathway?

Cobalamin synthase (cobS) in C. kluyveri functions as cobalamin 5′-phosphate synthase (TIGR01650) . It is a critical component in the biosynthesis pathway of cobalamin (vitamin B12), specifically involved in the nucleotide loop assembly. In aerobic pathways, cobS forms part of a complex with CobN-magnesium chelatase (pfam02514) and CobT-cobalt chelatase (TIGR01651) .

It's important to understand that the nomenclature of these enzymes can be confusing, as the enzymes CobT, CobU, and CobS were first described for nucleotide loop assembly in anaerobic organisms like S. typhimurium before the discovery of nonhomologous enzymes with the same names in aerobic pathways such as in P. denitrificans . Since C. kluyveri is a strict anaerobe , its cobS likely functions in the context of the anaerobic pathway.

Methodologically, to investigate cobS function in C. kluyveri, researchers should consider comparative genomic analysis with other clostridia and anaerobic bacteria to identify conserved functional domains and potential interaction partners specific to the anaerobic pathway.

How does cobS relate structurally and functionally to other enzymes in the cobalamin biosynthesis pathway?

CobS is part of a complex enzymatic network in cobalamin biosynthesis. In the context of C. kluyveri's anaerobic metabolism, cobS likely interacts with other enzymes in the pathway, although the exact interactions may differ from those observed in aerobic organisms.

The cobalamin biosynthesis pathway involves multiple methyltransferases, including cobalt-sirohydrochlorin C20-methyltransferase (CbiL), cobalt-precorrin-3 C17-methyltransferase (CbiH), and cobalt precorrin-4 C11-methyltransferase . These enzymes catalyze sequential modifications of the corrin ring structure before cobS activity.

To study these relationships experimentally, researchers should consider:

  • Co-expression studies with potential partner proteins

  • Pull-down assays to identify physical interactions

  • Activity assays in the presence and absence of partner proteins

  • Structural analysis of cobS alone and in complex with other pathway components

The cobQ gene, coding for cobyric acid synthase, has been identified in C. kluyveri (strain NBRC 12016) and is another important enzyme in this pathway that likely functions downstream of cobS.

What are the predicted conserved domains and active sites in C. kluyveri cobS?

While the search results don't provide specific information about conserved domains and active sites in C. kluyveri cobS, insights can be drawn from related cobalamin-binding proteins and enzymes.

Cobalamin-dependent enzymes typically contain specialized domains that bind each requisite substrate and the cobalamin cofactor . For example, in cobalamin-dependent methionine synthase, the cobalamin-binding domain (Cob) carries the cobalamin cofactor, and the adjacent Cap domain protects the reactive cofactor from unwanted side reactions .

For experimental identification of active sites in C. kluyveri cobS, researchers should consider:

  • Sequence alignment with characterized cobS proteins from other organisms

  • Site-directed mutagenesis of predicted catalytic residues

  • Activity assays with mutant versions to confirm the role of specific residues

  • Structural studies to identify binding pockets and catalytic sites

Particular attention should be paid to residues that might interact with ATP and the cobalamin precursor, as cobS functions as a phosphate synthase.

What are the optimal conditions for heterologous expression of recombinant C. kluyveri cobS?

Expressing recombinant cobS from the strict anaerobe C. kluyveri presents several challenges that researchers should address methodically:

  • Expression System Selection:

    • E. coli BL21(DE3) is often suitable for initial trials

    • Consider specialized strains designed for expression of proteins with complex folding requirements

    • For proteins requiring anaerobic conditions, consider expression under reduced oxygen tension

  • Vector Design:

    • Include a fusion tag (His6, GST, or MBP) to facilitate purification and potentially improve solubility

    • Consider codon optimization for the expression host

    • Include a precision protease cleavage site if tag removal is desired

  • Expression Conditions Table:

ParameterRange to TestNotes
Temperature15-30°CLower temperatures often improve folding
Induction OD6000.4-0.8Earlier induction may reduce inclusion body formation
Inducer concentration0.1-1.0 mM IPTGLower concentrations may improve solubility
Expression duration4-24 hoursMonitor protein integrity over time
Media compositionLB, TB, M9Rich media (TB) often increases yield
Oxygen levelAerobic to microaerobicConsider anaerobic expression systems
  • Additives to Consider:

    • Metal ions (particularly cobalt)

    • Osmolytes like glycerol or sorbitol

    • Reducing agents such as β-mercaptoethanol or DTT

Methodologically, researchers should implement a systematic optimization approach, testing these variables in combination and assessing both yield and activity of the recombinant protein.

What purification strategy is most effective for recombinant C. kluyveri cobS?

An effective purification strategy for recombinant C. kluyveri cobS should be designed based on its predicted biophysical properties and experimental requirements:

  • Initial Capture Step:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged cobS

    • Glutathione affinity chromatography for GST-tagged cobS

    • Amylose resin for MBP-tagged cobS

  • Intermediate Purification:

    • Ion exchange chromatography based on the theoretical pI of cobS

    • Heparin affinity chromatography if cobS is predicted to interact with nucleotides

  • Polishing Step:

    • Size exclusion chromatography to separate monomeric from aggregated forms

    • Remove any remaining contaminants

  • Buffer Optimization:

    • Test stability in various buffers (phosphate, Tris, HEPES)

    • Include stabilizing agents (10-20% glycerol, 1-5 mM DTT)

    • Consider including cobalt or other cofactors that might stabilize the protein

  • Quality Control:

    • SDS-PAGE to assess purity

    • Western blot to confirm identity

    • Dynamic light scattering to evaluate homogeneity

    • Activity assays to confirm functionality

Researchers studying related enzymes, such as cobalamin-dependent methionine synthase, have used thermophilic homologs due to their exceptional stability . This approach might be worth considering for cobS if the C. kluyveri enzyme proves unstable during purification.

What are the major challenges in obtaining active recombinant C. kluyveri cobS?

Obtaining active recombinant C. kluyveri cobS presents several challenges that researchers should anticipate and address:

  • Anaerobic Environment Requirements:

    • C. kluyveri is a strict anaerobe , and its proteins may require anaerobic conditions for proper folding and activity

    • Consider purification under anaerobic conditions or rapid transfer to anaerobic chambers after purification

  • Complex Formation:

    • CobS functions as part of a complex with CobN and CobT in aerobic pathways

    • The anaerobic cobS may also require interaction partners for stability or activity

    • Consider co-expression strategies or reconstitution of complexes in vitro

  • Cofactor Requirements:

    • As a cobalamin biosynthesis enzyme, cobS may require specific cofactors

    • Testing different metal ions, particularly cobalt, may be necessary

    • ATP is likely required for activity as a phosphate synthase

  • Protein Solubility:

    • Membrane association or hydrophobic regions may reduce solubility

    • Fusion partners (MBP, SUMO) may improve solubility

    • Detergents might be necessary if the protein has membrane-associated regions

  • Stability Concerns:

    • Proteins from anaerobes may be oxygen-sensitive

    • Include reducing agents in all buffers

    • Consider rapid activity assays immediately after purification

The successful approach with thermophilic homologs for studying cobalamin-binding proteins suggests that exploring thermophilic clostridia for more stable cobS homologs might be a productive alternative if C. kluyveri cobS proves too challenging to work with directly.

How should activity assays for recombinant C. kluyveri cobS be designed?

Designing appropriate activity assays for recombinant C. kluyveri cobS requires consideration of its function as cobalamin 5′-phosphate synthase. A methodological approach should include:

  • Direct Activity Measurement:

    • Substrate: Identify the appropriate cobalamin precursor

    • Cofactor: ATP as phosphate donor

    • Detection: HPLC or LC-MS to monitor conversion of substrate to phosphorylated product

    • Controls: Include reactions without enzyme, with heat-inactivated enzyme, and without ATP

  • Coupled Enzyme Assays:

    • Link cobS activity to ATP hydrolysis

    • Use pyruvate kinase and lactate dehydrogenase to couple ADP production to NADH oxidation

    • Monitor decrease in absorbance at 340 nm

  • Radioactive Assays:

    • Use γ-32P-ATP to track phosphate transfer

    • Separate reaction products by TLC or other chromatography methods

    • Quantify incorporation of radioactive phosphate into the product

  • Optimization Parameters Table:

ParameterRange to TestNotes
pH6.0-9.0Test in 0.5 pH unit increments
Temperature25-45°CC. kluyveri optimal growth at 35°C
Divalent cations1-10 mM Mg2+, Mn2+Essential for ATP-dependent enzymes
Cobalt concentration0.1-2 mMMay be required for substrate binding
Reducing conditions0-10 mM DTT or β-MEImportant for anaerobic enzymes
Substrate concentration10-500 μMFor Km determination
ATP concentration0.1-5 mMFor kinetic analysis
  • Data Analysis:

    • Determine Michaelis-Menten parameters (Km, Vmax)

    • Calculate kcat and catalytic efficiency (kcat/Km)

    • Analyze effects of different buffer components and additives

The assay should be performed under anaerobic conditions if possible, given C. kluyveri's strict anaerobic nature .

How can I investigate the interaction between cobS and other proteins in the cobalamin biosynthesis pathway?

Investigating protein-protein interactions involving C. kluyveri cobS requires multiple complementary approaches:

  • Co-expression and Co-purification Studies:

    • Design constructs for co-expression of cobS with potential partners (e.g., CobN, CobT)

    • Include different affinity tags on each protein

    • Perform tandem affinity purification to isolate intact complexes

    • Analyze complex composition by SDS-PAGE and mass spectrometry

  • In vitro Reconstitution:

    • Purify individual components separately

    • Mix under controlled conditions to reconstitute complexes

    • Analyze by size exclusion chromatography or native PAGE

    • Compare activities of individual proteins versus reconstituted complexes

  • Biophysical Interaction Analysis:

    • Surface Plasmon Resonance (SPR) to determine binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for binding studies with minimal protein consumption

  • Structural Studies:

    • X-ray crystallography of complexes

    • Cryo-electron microscopy for larger assemblies

    • Crosslinking Mass Spectrometry (XL-MS) to identify interaction interfaces

  • Functional Assays:

    • Compare activity of cobS alone versus in complex

    • Perform mutational analysis of predicted interaction interfaces

    • Develop FRET-based assays to monitor interactions in real-time

Studies on cobalamin-dependent methionine synthase have revealed that achieving different methylation reactions "necessitates significant domain rearrangements to facilitate substrate access to the cobalamin cofactor at the right time" . Similar dynamics might occur in the cobS complex, requiring specialized techniques to capture transient interactions.

What statistical approaches are appropriate for analyzing cobS enzyme kinetics data?

Robust statistical analysis of enzyme kinetics data for C. kluyveri cobS should include:

  • Enzyme Kinetics Model Selection:

    • Michaelis-Menten for simple kinetics

    • Hill equation if cooperativity is observed

    • Competitive, noncompetitive, or uncompetitive inhibition models when studying inhibitors

    • Bisubstrate models if analyzing both ATP and cobalamin precursor binding

  • Appropriate Fitting Methods:

    • Nonlinear regression (preferred over linearization methods)

    • Weighted fitting if error increases with substrate concentration

    • Global fitting for multiple datasets with shared parameters

  • Statistical Validation:

    • Calculate and report confidence intervals for all parameters (Km, Vmax, kcat)

    • Perform residual analysis to check goodness of fit

    • Use AIC or BIC for model comparison when testing multiple models

  • Replicate Analysis:

    • Minimum of three independent experiments

    • Use both technical and biological replicates

    • Apply ANOVA when comparing multiple conditions

    • Use appropriate post-hoc tests (Tukey's, Dunnett's) for multiple comparisons

  • Data Visualization:

    • Direct plots of velocity vs. substrate concentration with fitted curves

    • Double-reciprocal plots only for visualization, not for parameter estimation

    • Residual plots to assess systematic deviations from the model

  • Special Considerations for Multicomponent Systems:

    • If cobS functions in a complex, analyze both individual and complex kinetics

    • Consider synergistic or antagonistic effects between components

    • Develop more complex models that account for protein-protein interactions

A statistical approach similar to what has been used in repeated measure analysis in other experimental designs could be adapted for enzyme kinetics time course data , ensuring appropriate handling of time-dependent measurements and nested variables.

How does the anaerobic pathway of cobalamin biosynthesis in C. kluyveri differ from aerobic pathways?

The cobalamin biosynthesis pathway in anaerobic C. kluyveri differs significantly from aerobic pathways:

  • Key Enzymatic Differences:

    • "CobNST in the aerobic pathway are nonhomologous to the enzymes with the same symbols in the anaerobic pathway due to their discovery history"

    • The aerobic pathway uses an ATP-dependent cobalt chelatase complex (CobNST)

    • The anaerobic pathway in organisms like S. typhimurium uses ATP-independent enzymes CbiK/X for cobalt insertion

  • Oxygen Requirements and Sensitivity:

    • Aerobic pathways incorporate oxygen directly into reactions

    • Anaerobic pathways use alternative chemistry that functions without oxygen

    • C. kluyveri, being a strict anaerobe , likely employs oxygen-independent mechanisms

  • Corrin Ring Synthesis:

    • Different timing of cobalt insertion between pathways

    • Anaerobic pathway typically involves early cobalt insertion

    • Different intermediates form along each pathway

  • Genetic Organization:

    • Aerobic pathway genes often labeled with "cob" prefix

    • Anaerobic pathway genes often labeled with "cbi" prefix

    • C. kluyveri genome contains specific adaptations for its anaerobic lifestyle

  • Evolutionary Considerations:

    • The anaerobic pathway is considered evolutionarily older

    • C. kluyveri's pathway likely represents an ancient form of cobalamin biosynthesis

To experimentally investigate these differences, researchers should perform comparative genomic analysis between C. kluyveri and aerobic cobalamin producers, followed by functional characterization of the identified enzymes and pathway intermediates.

What structural features enable cobS to function in the anaerobic environment of C. kluyveri?

The structural features enabling cobS to function in C. kluyveri's anaerobic environment likely include:

  • Oxygen-Independent Catalytic Mechanism:

    • Absence of oxygen-requiring catalytic steps

    • Alternative chemistry for reactions that typically use oxygen in aerobic pathways

    • Specialized active site architecture optimized for anaerobic conditions

  • Redox-Sensitive Residues:

    • Strategic placement of cysteine residues that may form disulfide bonds

    • Residues sensitive to oxidation likely protected or absent

    • Potential iron-sulfur clusters for electron transfer (C. kluyveri has genes for iron-sulfur proteins )

  • Metal Coordination:

    • Specific coordination of metal ions (particularly cobalt)

    • Residues that protect metal centers from oxidation

    • The genome of C. kluyveri contains genes for [FeFe]-hydrogenases and ferredoxins , suggesting mechanisms for handling sensitive metal centers

  • Substrate Binding Pockets:

    • Adaptations for binding partially reduced cobalamin precursors

    • Specialized binding sites for anaerobic pathway intermediates

    • Interface features for interaction with other anaerobic pathway enzymes

  • Structural Stability:

    • Adaptations promoting stability in the absence of oxygen

    • Features that might destabilize in oxidizing environments

    • Potential conformational changes that protect sensitive residues

Research on cobalamin-dependent methionine synthase has shown that each substrate and cofactor binding site must be positioned to bind its respective ligand while allowing for "nuanced local rearrangements" around catalytic residues . Similar structural dynamics are likely important for cobS function.

How do the unique metabolic features of C. kluyveri impact cobalamin biosynthesis?

C. kluyveri possesses several unique metabolic features that likely influence its cobalamin biosynthesis pathway:

  • Nitrogen Fixation Capability:

    • C. kluyveri can fix nitrogen and requires molybdenum for growth

    • Contains genes for molybdenum-dependent, vanadium-dependent, and iron-only nitrogenases

    • Potential metabolic connections between nitrogen fixation and cobalamin biosynthesis through shared metal cofactor metabolism

  • Active Sulfur Metabolism:

    • C. kluyveri has an "extremely active sulfur metabolism"

    • Contains clustered genes for sulfate adenylyltransferase, adenylylsulfate reductase, and other sulfur metabolism enzymes

    • Sulfur metabolism may provide precursors for methionine synthesis, which connects to cobalamin metabolism

  • Specialized Fermentation Pathways:

    • Unique fermentation capabilities including ethanol and acetate utilization

    • Butyryl-CoA and caproyl-CoA formation pathways

    • These central metabolic pathways likely provide precursors for corrinoid synthesis

  • Metal Homeostasis:

    • Sophisticated systems for handling metal ions, particularly important for cobalt incorporation in cobalamin

    • Contains genes for [FeFe]-hydrogenases and ferredoxins with [4Fe-4S] iron sulfur centers

    • These systems may be involved in maintaining the right redox environment for cobalamin biosynthesis

  • S-adenosylmethionine (SAM) Metabolism:

    • Contains multiple S-adenosylmethionine synthetases (MetK)

    • SAM is a critical methyl donor in cobalamin biosynthesis

    • Connections between SAM metabolism and cobalamin production likely exist

These metabolic features create a unique cellular environment that may require specific adaptations of the cobalamin biosynthesis pathway. Researchers should consider these interconnections when designing experiments to study recombinant cobS or when reconstituting the pathway in heterologous systems.

How does C. kluyveri cobS compare to homologous enzymes from other anaerobic bacteria?

Comparative analysis of C. kluyveri cobS with homologous enzymes from other anaerobic bacteria reveals evolutionary insights:

  • Sequence Conservation Among Anaerobes:

    • cobS from anaerobic organisms typically shows sequence conservation in catalytic domains

    • C. kluyveri cobS likely shares higher similarity with other clostridia than with distant anaerobes

    • Key functional residues are expected to be conserved across anaerobic cobS enzymes

  • Comparative Features Table:

FeatureC. kluyveri cobSS. typhimurium (anaerobic)B. megaterium (anaerobic)P. denitrificans (aerobic)
PathwayAnaerobicAnaerobicAnaerobicAerobic
FunctionCobalamin 5′-phosphate synthaseNucleotide loop assemblySimilar to S. typhimuriumPart of CobNST complex
ATP DependenceLikely yesYesYesYes
Cobalt InsertionLikely via CbiK/XVia CbiKVia CbiXVia CobNST complex
Genomic ContextTBD from genome analysisWell-characterizedCharacterizedWell-characterized
  • Structural Adaptations:

    • Similar core structure among anaerobic cobS enzymes

    • Variations in substrate-binding regions based on specific pathway intermediates

    • C. kluyveri may have unique adaptations related to its specialized metabolism

  • Functional Differences:

    • Substrate specificity may vary between species

    • Catalytic efficiency differences based on cellular environment

    • Regulatory mechanisms likely adapted to each organism's lifestyle

  • Evolutionary Implications:

    • The anaerobic pathway is considered evolutionarily older

    • C. kluyveri's cobS likely represents a more ancient form of the enzyme

    • Comparing with diverse anaerobes can highlight conserved ancestral features

For experimental validation, researchers could perform heterologous expression of cobS from multiple anaerobic species, followed by biochemical characterization to identify functional similarities and differences.

What is known about the evolutionary history of cobS in the context of cobalamin biosynthesis pathways?

The evolutionary history of cobS provides insights into the ancient origins of cobalamin biosynthesis:

  • Pathway Evolution:

    • The anaerobic pathway is generally considered evolutionarily older

    • CobS in anaerobic organisms like C. kluyveri likely represents an ancient form of the enzyme

    • The aerobic pathway evolved later, with nonhomologous enzymes acquiring similar names due to discovery history

  • Gene Duplication and Divergence:

    • Some organisms contain multiple cobS-like genes

    • C. kluyveri has multiple sets of genes for certain metabolic pathways

    • Gene duplication events likely contributed to specialization of function

  • Horizontal Gene Transfer:

    • Cobalamin biosynthesis genes show evidence of horizontal transfer across bacterial lineages

    • The presence of cobS in diverse bacterial phyla suggests ancient gene transfer events

    • C. kluyveri may have acquired or modified cobS through horizontal transfer

  • Adaptation to Environmental Niches:

    • CobS has adapted to function in different cellular environments

    • C. kluyveri's strict anaerobic lifestyle has likely shaped its cobS structure and function

    • The enzyme shows adaptations specific to the unique metabolism of C. kluyveri

  • Conservation of Critical Functions:

    • Despite divergence, the fundamental catalytic function is preserved

    • Key catalytic residues and binding motifs show higher conservation

    • The core mechanism of cobalamin 5′-phosphate synthesis is maintained across diverse species

Evolutionary analysis of cobS could provide valuable insights into the origins of cobalamin biosynthesis and help identify conserved features that are essential for function, guiding mutagenesis studies and protein engineering efforts.

How can phylogenetic analysis inform experimental approaches to studying C. kluyveri cobS?

Phylogenetic analysis of cobS can strategically inform experimental approaches:

  • Selection of Experimental Models:

    • Identify close homologs with established expression and purification protocols

    • Select thermophilic relatives for stability in structural studies (similar to the approach used for cobalamin-dependent methionine synthase )

    • Choose diverse representatives for comparative biochemical analysis

  • Targeted Mutagenesis Design:

    • Identify highly conserved residues likely essential for function

    • Locate clade-specific residues that may confer specialized properties

    • Design mutations that transform specificity or function based on differences between clades

  • Chimeric Protein Strategy:

    • Design chimeric proteins combining domains from different cobS homologs

    • Swap specific regions between aerobic and anaerobic cobS to identify functional determinants

    • Create fusion proteins to test domain autonomy and interchangeability

  • Co-evolution Analysis:

    • Identify co-evolving residues within cobS that may be functionally coupled

    • Detect co-evolution between cobS and partner proteins to predict interaction sites

    • Use this information to guide complex reconstitution experiments

  • Taxonomic Selection for Comparative Studies:

    • Include representatives from different clades for comparative analysis

    • Select organisms with diverse metabolic capabilities to assess correlation with cobS function

    • Include both closely related clostridia and distant anaerobes to balance depth and breadth

  • Ancestral Sequence Reconstruction:

    • Infer ancestral cobS sequences at key evolutionary nodes

    • Express and characterize reconstructed ancestral enzymes

    • Compare properties of ancient and modern enzymes to understand evolutionary trajectories

By integrating phylogenetic information with experimental approaches, researchers can develop more focused and informative studies of C. kluyveri cobS, potentially revealing fundamental insights into cobalamin biosynthesis evolution and mechanism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.