Recombinant Clostridium kluyveri Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Functional Role in Energy Metabolism

EcfT functions as the transmembrane module of the ECF transporter complex, which couples ATP hydrolysis (via ATPases EcfA/A') to substrate (e.g., vitamins) uptake . In C. kluyveri, EcfT works synergistically with:

  • Rnf Complex: A membrane-bound NADH:ferredoxin oxidoreductase involved in generating ion gradients .

  • Bcd/EtfAB Complex: Cytoplasmic enzymes coupling butyryl-CoA formation to ferredoxin reduction .

This system enables energy conservation via flavin-based electron bifurcation, a mechanism critical for anaerobic growth on ethanol and acetate . For example, the ECF transporter facilitates NADP+ reduction using reduced ferredoxin (Fd<sub>red</sub>) and NADH in a reversible reaction:
Fdred2+NADH+2 NADP++H+Fdox+NAD++2 NADPH\text{Fd}_{\text{red}}^{2-} + \text{NADH} + 2\ \text{NADP}^+ + \text{H}^+ \rightarrow \text{Fd}_{\text{ox}} + \text{NAD}^+ + 2\ \text{NADPH} .

Recombinant Production and Applications

Recombinant EcfT is produced in heterologous systems (e.g., E. coli) for structural and functional studies . Key findings include:

  • Inhibitor Development: Coarse-grained molecular dynamics simulations identified inhibitors targeting ECF transporters, with EcfT as a key binding site .

  • Biotechnological Potential: ECF transporters are absent in humans, making EcfT a target for antimicrobial agents .

  • Metabolic Engineering: C. kluyveri’s ECF machinery has been leveraged in cocultures for caproate production (up to 200 mM in 40–50 hours) .

Research Challenges and Future Directions

  • Structural Resolution: The full 3D structure of EcfT remains uncharacterized, limiting mechanistic insights .

  • Functional Redundancy: C. kluyveri harbors multiple nitrogenases and molybdate transporters, complicating metabolic studies .

  • Industrial Scaling: High glycerol content in storage buffers (50%) poses challenges for large-scale protein applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format in the order notes section. We will do our best to fulfill your specific requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice for shipping, please communicate this requirement to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure that the contents settle at the bottom. Reconstitute the protein using deionized sterile water to achieve a concentration ranging from 0.1 to 1.0 mg/mL. We suggest the addition of 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid formulations maintain their quality for 6 months when stored at -20°C/-80°C. Lyophilized forms exhibit a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquotting is recommended for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Should you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
ecfT; CKL_0256; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Target Names
ecfT
Target Protein Sequence
MIKDITIGQYVPGDSFIHKLDPRVKILISLIYIVDLFIVNSFKGYIFIVVFTLISILVSK VQFTYIYKGLKPIFILVLITAVLNIFMTGGANPPLFKWKFLVVYREGLIMAAFMALRLVF LIIGTSLLTLTTSPIELTDGIEKLLKPVSKIGVPSHELAMMMTIALRFIPTLMDETDKIM KAQIARGADLESGNLIQKAKNLVPILVPLFISSFRRADELAMAMEARCYRGGDGRTRMKE LKLSNRDFIASLCALVLVCISILSRIWWGK
Uniprot No.

Target Background

Function
The transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike conventional ABC transporters, this ECF transporter provides the energy necessary for the transport of various substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Energy-coupling Factor (ECF) Transporter System in Clostridium kluyveri?

The Energy-coupling factor (ECF) transporters represent a specialized family of membrane transporters found in prokaryotes, including Clostridium kluyveri. These transporters share organizational similarities with ATP-binding cassette transporters while maintaining distinctive structural features. A complete ECF transporter system consists of four critical components: two cytosolic ATPases (designated as EcfA and EcfA'), a membrane-embedded substrate-binding protein (EcfS), and a transmembrane energy-coupling component (EcfT) that serves as the connecting link between the EcfA-EcfA' subcomplex and the EcfS component . In C. kluyveri, these transporters play crucial roles in nutrient acquisition and energy metabolism within the anaerobic environment where this organism thrives .

The ECF transporter systems in C. kluyveri function by coupling ATP hydrolysis to the translocation of various substrates across the cell membrane. This energy-dependent transport mechanism allows the organism to import essential nutrients even when present at low concentrations in the environment, contributing to the metabolic versatility that characterizes C. kluyveri as an organism of biotechnological interest .

What is the structural architecture of the EcfT component?

The EcfT component exhibits a distinctive horseshoe-shaped open architecture within the cell membrane. Structural analyses reveal that EcfT typically contains five α-helices that function as transmembrane segments, alongside two cytoplasmic α-helices that serve as coupling modules connecting to the cytosolic ATPase components (EcfA and EcfA') . This architectural arrangement facilitates the specialized function of EcfT as the central coordinating component of the ECF transporter complex.

The transmembrane segments of EcfT create a framework that anchors the complex within the cell membrane, while simultaneously forming the binding interface for the substrate-binding S component. Notably, crystallographic studies have demonstrated that the S component binds horizontally along the lipid membrane and interfaces exclusively with the five transmembrane segments and two cytoplasmic helices of the T component . This unusual binding orientation represents a unique structural feature of ECF transporters that distinguishes them from other membrane transport systems in prokaryotes.

How does the EcfT protein contribute to substrate specificity in C. kluyveri?

The EcfT protein plays a crucial role in the substrate specificity of the ECF transporter system in C. kluyveri through its interaction with various S-components. While the EcfT component itself does not directly determine substrate specificity, it functions as the essential coupling element that coordinates the activities of substrate-specific S-components with the energy-providing A-components.

In C. kluyveri, the EcfT protein likely participates in the transport of various micronutrients, including vitamins and trace elements that support the organism's unique metabolic capabilities. This is particularly significant given C. kluyveri's distinctive metabolic pathways, including its ability to form caproic acid and hexanol from ethanol and butyrate, and its capacity for nonribosomal synthesis of peptide-polyketide hybrids . The EcfT protein may therefore be instrumental in acquiring the specific cofactors and nutrients that enable these specialized metabolic functions.

What are the optimal expression systems for recombinant production of C. kluyveri EcfT?

The expression of recombinant C. kluyveri EcfT presents significant challenges due to its hydrophobic nature as a membrane protein with multiple transmembrane domains. Based on analogous studies with other membrane proteins from Clostridium species, E. coli expression systems represent a primary option for heterologous production of C. kluyveri EcfT .

For optimal expression in E. coli, researchers should consider the following methodological approach:

  • Vector selection: pET-based expression vectors containing T7 promoter systems offer strong, inducible expression suitable for membrane proteins. The incorporation of fusion tags (such as His6, Strep-II, or MBP) at either the N-terminus or C-terminus facilitates downstream purification and potentially enhances stability.

  • Host strain optimization: E. coli strains specifically engineered for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3), typically yield superior results compared to standard BL21(DE3) strains when expressing integral membrane proteins like EcfT.

  • Expression conditions: Lowering the induction temperature to 16-20°C and reducing inducer concentration can significantly improve the proper folding and membrane insertion of EcfT, minimizing the formation of inclusion bodies.

Alternative expression systems that may be explored include:

  • Yeast systems (Pichia pastoris or Saccharomyces cerevisiae)

  • Baculovirus-infected insect cells

  • Cell-free expression systems supplemented with lipid nanodiscs or detergent micelles

Each expression system offers distinct advantages for membrane protein production, and the optimal choice may require empirical determination through parallel expression trials.

What purification strategies are most effective for recombinant C. kluyveri EcfT?

Purification of EcfT presents unique challenges due to its hydrophobic nature and multiple transmembrane domains. The following methodological workflow has proven effective for similar membrane proteins:

Table 1: Step-wise Purification Strategy for Recombinant C. kluyveri EcfT

StepMethodologyCritical ParametersExpected Outcome
1. Membrane IsolationDifferential centrifugation following cell disruptionBuffer: 50 mM Tris-HCl (pH 8.0), 200 mM NaCl, 10% glycerolEnriched membrane fraction containing EcfT
2. SolubilizationDetergent extractionOptimal detergents: n-Dodecyl-β-D-maltoside (DDM), Lauryl maltose neopentyl glycol (LMNG) at 1-2% (w/v)Solubilized EcfT in detergent micelles
3. Affinity ChromatographyIMAC (for His-tagged constructs)Buffer containing 0.05-0.1% detergent; Imidazole gradient elution70-80% purity EcfT preparation
4. Size Exclusion ChromatographySuperdex 200 or equivalentBuffer: 20 mM HEPES (pH 7.5), 150 mM NaCl, 0.05% detergent>90% pure EcfT preparation

For functional studies requiring the complete ECF transporter complex, co-expression strategies incorporating the genes encoding EcfA, EcfA', and specific EcfS components should be considered. Alternatively, in vitro reconstitution of the complex from individually purified components can be attempted, though this approach typically yields lower recovery of functional complexes .

The choice of detergent is critical for maintaining EcfT stability and native conformation. In addition to traditional detergents, newer amphipathic polymers like styrene-maleic acid (SMA) copolymers offer the advantage of extracting membrane proteins together with their native lipid environment, potentially preserving functional properties more effectively than conventional detergent solubilization.

How can researchers verify the proper folding and functionality of purified recombinant EcfT?

Verifying the structural integrity and functionality of purified EcfT presents significant challenges since the protein functions as part of a multicomponent complex. A comprehensive validation approach should include multiple complementary techniques:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content consistent with the predicted alpha-helical transmembrane domains

    • Thermostability assays (differential scanning fluorimetry or nanoDSF) to assess protein stability and potential ligand interactions

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state and homogeneity

  • Reconstitution studies:

    • Incorporation into liposomes or nanodiscs to recreate a membrane environment

    • In vitro assembly with purified EcfA, EcfA', and EcfS components to form complete ECF complexes

    • Fluorescence-based binding assays to verify interactions with partner components

  • Functional validation:

    • ATPase activity assays measuring stimulation of EcfA/A' ATPase activity in the presence of EcfT

    • Substrate transport assays using proteoliposomes containing reconstituted ECF complexes

    • Complementation studies in bacterial strains deficient in ECF transporter components

Researchers should be aware that the functional activity of EcfT likely depends on proper reconstitution with its partner components and the lipid environment. The development of a fluorescence-based binding assay to monitor the interaction between EcfT and partner proteins represents a valuable tool for screening expression and purification conditions that preserve functional competence.

What is known about the genetic organization of the ecfT gene in C. kluyveri?

The ecfT gene in Clostridium kluyveri is part of the organism's 3.96 Mbp circular chromosome, which has been completely sequenced . While the genomic database provides the sequence information for the ecfT gene, its precise genomic context requires careful examination to understand its regulation and functional relationships.

Analysis of the genomic context surrounding the ecfT gene may reveal additional insights into substrate specificity and regulatory mechanisms. For example, the presence of specific S-component genes in the vicinity could indicate preferred substrates for the transporter system, while the identification of regulatory elements might elucidate conditions that modulate transporter expression.

Researchers investigating the ecfT gene should utilize comparative genomic approaches to identify conserved features and potentially novel aspects of ECF transporter organization in C. kluyveri relative to other Clostridium species and more distant prokaryotic lineages.

What mutation strategies are most informative for structure-function analysis of EcfT?

Structure-function analysis of EcfT can be systematically approached through targeted mutations that probe specific hypotheses regarding protein function. The following mutation strategies provide complementary insights:

  • Transmembrane domain mutations:

    • Alanine-scanning mutagenesis of the five transmembrane segments to identify residues critical for S-component binding

    • Introduction of helix-breaking residues (proline) to assess the structural integrity requirements of each transmembrane segment

    • Conservative and non-conservative substitutions at the lipid-protein interface to examine lipid interaction requirements

  • Coupling helix mutations:

    • Targeted substitutions within the cytoplasmic coupling helices that interact with the EcfA/A' components

    • Charge-reversal mutations at the EcfA/A' interface to disrupt electrostatic interactions

    • Introduction of rigid linkers to constrain conformational flexibility

  • Domain deletion and chimeric constructs:

    • Construction of chimeric proteins combining EcfT domains from different species to probe specificity determinants

    • Minimal domain constructs to identify independently folding structural modules

    • Insertion of reporter groups at domain boundaries to monitor conformational changes

When designing mutation studies, researchers should consider the following methodological approach:

Table 2: Recommended Workflow for EcfT Structure-Function Analysis

Analysis StageTechniquesExpected Outcomes
Computational AnalysisSequence alignment, homology modeling, evolutionary coupling analysisIdentification of conserved residues and co-evolving networks
Mutation DesignRational design based on structural models and conservation patternsSet of mutations targeting specific functional hypotheses
Expression ScreeningSmall-scale expression tests of mutant variantsIdentification of stable, expressible variants
Functional CharacterizationIn vitro reconstitution, binding assays, ATPase stimulationCorrelation of structural features with specific functions
In vivo ValidationComplementation of ECF transporter deficient strainsPhysiological relevance of identified structure-function relationships

The interpretation of mutation studies should integrate available structural data from related ECF transporters to place findings in the context of the transporter's conformational cycle and mechanism of energy coupling.

How can researchers effectively analyze the interaction between EcfT and other ECF transporter components?

The analysis of protein-protein interactions between EcfT and other ECF transporter components requires a multifaceted approach combining in vitro and in vivo techniques. The following methodological strategies provide complementary insights:

  • Biochemical interaction assays:

    • Pull-down assays using affinity-tagged components to verify direct interactions

    • Surface plasmon resonance (SPR) or biolayer interferometry (BLI) for quantitative binding kinetics

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of interaction

    • Chemical cross-linking coupled with mass spectrometry to map interaction interfaces

  • Structural studies:

    • Cryo-electron microscopy of reconstituted complexes at different stages of the transport cycle

    • X-ray crystallography of subcomplexes or full assemblies in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify protected interfaces

    • Förster resonance energy transfer (FRET) assays between labeled components to monitor conformational changes

  • Computational approaches:

    • Molecular docking simulations to predict interaction interfaces

    • Molecular dynamics simulations to assess stability of proposed complexes

    • Coevolutionary analysis to identify coevolving residue networks between components

  • In vivo validation:

    • Bacterial two-hybrid assays to verify interactions in a cellular context

    • Split protein complementation assays (e.g., split-GFP) to visualize interactions in living cells

    • Suppressor mutation analysis to identify compensatory mutations that restore function

When designing interaction studies, researchers should consider using truncated constructs or isolated domains to map specific interaction regions, particularly for the coupling helices of EcfT that interact with the EcfA/A' components. Additionally, the lipid environment significantly influences membrane protein interactions, necessitating careful consideration of detergent or lipid composition during reconstitution experiments.

The integration of data from multiple interaction analysis techniques is essential for developing a comprehensive model of how EcfT coordinates the functions of other ECF transporter components during the substrate transport cycle.

What experimental approaches can determine the substrate specificity profile of C. kluyveri ECF transporters containing EcfT?

Determining the substrate specificity of ECF transporters containing C. kluyveri EcfT requires systematic analysis of transport capabilities across multiple potential substrates. The following experimental approaches offer complementary insights:

  • Reconstituted proteoliposome transport assays:

    • Reconstitution of purified ECF complexes (containing EcfT, EcfA, EcfA', and specific EcfS components) into liposomes

    • Transport assays using radiolabeled or fluorescently labeled substrates to measure uptake kinetics

    • Competition assays with unlabeled substrates to determine relative affinities

  • Genetic complementation strategies:

    • Expression of C. kluyveri ECF components in bacterial strains auxotrophic for specific vitamins or micronutrients

    • Growth rescue experiments to identify transported substrates

    • Construction of chimeric transporters with heterologous S-components to expand or alter specificity

  • Direct binding measurements:

    • Isothermal titration calorimetry (ITC) with purified S-components to measure substrate binding affinities

    • Fluorescence-based binding assays using environmentally sensitive fluorophores

    • Surface plasmon resonance (SPR) with immobilized S-components to determine binding kinetics

  • Metabolomic approaches:

    • Comparative metabolomics of wild-type and ECF transporter-deficient C. kluyveri strains

    • Tracking isotopically labeled substrates to monitor transport into cells

    • Correlation of metabolite profiles with transporter expression levels

Based on the known metabolic capabilities of C. kluyveri, researchers should prioritize testing the following potential substrates for ECF transporter-mediated uptake:

Table 3: Potential Substrates for C. kluyveri ECF Transporters

Substrate CategorySpecific CompoundsRelevance to C. kluyveri Metabolism
VitaminsThiamine, riboflavin, biotin, folateCofactors for key metabolic enzymes
Trace MetalsNickel, cobalt, ironRequired for hydrogenases and other metalloenzymes
Amino AcidsMethionine, selenomethionineRelevant to C. kluyveri's unusual selenium metabolism
NucleobasesUracil, thyminePrecursors for nucleic acid synthesis

The integration of complementary approaches is essential for developing a comprehensive substrate specificity profile, as each technique offers distinct advantages and limitations.

How does EcfT contribute to the bioenergetics of substrate transport in C. kluyveri?

The EcfT component plays a central role in coupling ATP hydrolysis to substrate translocation in ECF transporters. In C. kluyveri, this energy coupling mechanism is particularly significant given the organism's unique energy metabolism as an anaerobe capable of growing on ethanol and acetate .

The bioenergetic contribution of EcfT can be experimentally investigated through several complementary approaches:

  • ATP consumption measurements:

    • Quantification of ATP hydrolysis rates in reconstituted systems containing EcfT and EcfA/A'

    • Correlation of ATP hydrolysis with substrate transport rates to determine coupling efficiency

    • Comparison of basal and substrate-stimulated ATPase activities

  • Conformational change analysis:

    • Spectroscopic techniques (FRET, EPR) to monitor conformational changes in EcfT during the transport cycle

    • Single-molecule FRET to detect conformational dynamics at different ATP concentrations

    • Hydrogen-deuterium exchange mass spectrometry to identify regions undergoing conformational rearrangements

  • Mutational analysis of coupling mechanism:

    • Site-directed mutagenesis of conserved residues in the coupling helices

    • Construction of ATP-binding site mutants in EcfA/A' to assess effects on EcfT conformation

    • Analysis of uncoupling mutations that permit ATP hydrolysis without substrate transport

The unusual horizontal binding of the S-component to the T-component in ECF transporters suggests a unique toppling mechanism during substrate translocation . This model proposes that ATP binding and hydrolysis by the EcfA/A' components induce conformational changes in EcfT that reorient the substrate-bound S-component. The coupling helices of EcfT likely serve as the mechanical link that transmits conformational energy from the ATPase domains to the S-component, resulting in substrate release into the cytoplasm.

Understanding the precise bioenergetic contribution of EcfT is essential for elucidating how C. kluyveri maintains efficient nutrient acquisition under energy-limited anaerobic conditions.

What role might the ECF transporters containing EcfT play in C. kluyveri's adaptations to its ecological niche?

The ECF transporters containing EcfT likely play crucial roles in C. kluyveri's adaptation to its ecological niche as a strict anaerobe with unique metabolic capabilities. Several lines of evidence suggest specific adaptive functions:

  • Micronutrient acquisition in competitive environments:

    • ECF transporters typically transport essential vitamins and trace elements with high affinity

    • This high-affinity transport would be advantageous for C. kluyveri in nutrient-limited anaerobic environments

    • The ability to scavenge limiting micronutrients could support C. kluyveri's specialized metabolism, including caproate production

  • Support for specialized metabolic pathways:

    • C. kluyveri possesses unusual metabolic capabilities, including the formation of caproic acid and hexanol from ethanol and butyrate

    • These pathways require specific cofactors and trace elements that may be transported by ECF systems

    • The selenium metabolism of C. kluyveri, including selenomethionine incorporation into acetoacetyl-CoA thiolase, may depend on specialized transporters

  • Energy-efficient transport mechanisms:

    • As an anaerobe with limited energy-generating capacity, C. kluyveri would benefit from the energy efficiency of ECF transporters

    • The coupling of transport to ATP hydrolysis provides a direct regulatory mechanism linking nutrient uptake to cellular energy status

    • This regulation would be particularly important during transitions between different growth substrates

Experimental approaches to investigate the ecological significance of ECF transporters in C. kluyveri include:

  • Comparative transcriptomics to identify conditions that upregulate ecfT expression

  • Competition experiments between wild-type and ECF transporter-deficient strains under different nutrient limitations

  • In situ expression studies examining transporter gene expression in natural communities containing C. kluyveri

The metabolic versatility of C. kluyveri, particularly its ability to produce valuable medium-chain fatty acids like caproate, has generated interest in biotechnological applications . Understanding the role of ECF transporters in supporting this metabolism could provide insights for optimizing production strains and culture conditions.

How can structural data on EcfT inform the rational design of C. kluyveri strains with enhanced substrate uptake capabilities?

Structural insights into EcfT can guide rational strain engineering strategies to enhance substrate uptake in C. kluyveri, potentially improving its biotechnological applications such as caproate production . Several structure-based engineering approaches warrant investigation:

  • Enhanced transporter expression:

    • Identification of structural features affecting protein stability and membrane insertion

    • Modification of transmembrane domains to improve folding efficiency

    • Optimization of signal sequences and membrane targeting

  • Altered substrate specificity:

    • Engineering the interaction interface between EcfT and S-components

    • Construction of chimeric transporters incorporating S-components with desired specificities

    • Directed evolution targeting the EcfT-S-component interface to accommodate novel substrates

  • Improved energy coupling efficiency:

    • Modifications to coupling helices to optimize conformational changes

    • Engineering of the EcfT-EcfA/A' interface to enhance communication

    • Introduction of stabilizing interactions to reduce basal ATP hydrolysis

The implementation of these strategies should consider the unique metabolic context of C. kluyveri. For instance, enhancing the uptake of cofactors required for medium-chain fatty acid production could directly support caproate synthesis pathways . Similarly, optimizing the import of trace metals needed for hydrogenase function could improve hydrogen metabolism and associated energy generation .

A rational design workflow would include:

  • In silico modeling and simulation of proposed modifications

  • Small-scale screening of variant libraries in heterologous hosts

  • Integration of promising variants into C. kluyveri

  • Physiological characterization under relevant cultivation conditions

This structure-guided approach offers advantages over traditional random mutagenesis by focusing engineering efforts on functionally relevant protein regions identified through structural analysis.

What are the challenges and solutions for studying ECF transporter dynamics using advanced biophysical techniques?

Studying the dynamic behavior of ECF transporters presents significant technical challenges due to their complex multi-component nature and membrane environment. Several advanced biophysical approaches offer solutions to these challenges:

  • Cryo-electron microscopy:

    • Challenge: Capturing different conformational states during the transport cycle

    • Solution: Time-resolved cryo-EM coupled with substrate or ATP analogs to trap intermediates

    • Methodological approach: GraFix technique to stabilize complexes, focused classification for conformational heterogeneity

  • Single-molecule techniques:

    • Challenge: Low signal-to-noise ratio for membrane proteins

    • Solution: Site-specific labeling with bright, photostable fluorophores

    • Methodological approach: Total internal reflection fluorescence (TIRF) microscopy of reconstituted transporters in supported lipid bilayers

  • Mass spectrometry:

    • Challenge: Maintaining intact complexes during ionization

    • Solution: Native mass spectrometry with optimized detergent removal

    • Methodological approach: Ion mobility MS to resolve conformational states

  • Computational simulations:

    • Challenge: Computational cost of simulating complete transporter dynamics

    • Solution: Enhanced sampling techniques and coarse-grained models

    • Methodological approach: Metadynamics or umbrella sampling to explore energy landscapes of conformational transitions

For time-resolved structural studies, researchers should consider developing a synchronized transport assay that allows sampling at defined points in the transport cycle. One promising approach involves the use of caged ATP compounds that can be rapidly activated by photolysis, triggering synchronized ATP hydrolysis and associated conformational changes across a population of transporters.

The interpretation of dynamic data requires integration across techniques and correlation with functional transport measurements. For example, the kinetics of conformational changes observed in single-molecule studies should be reconciled with the rates of ATP hydrolysis and substrate transport to develop a coherent mechanistic model.

How might the study of ECF transporters in C. kluyveri inform the development of novel antimicrobial strategies?

The study of ECF transporters in C. kluyveri offers unique insights that could inform antimicrobial development, particularly against pathogenic Clostridium species and other prokaryotes that rely on ECF transporters for essential nutrient acquisition . Several research directions warrant exploration:

  • Targeting ECF transporters in pathogens:

    • Comparative analysis of EcfT structural features between C. kluyveri and pathogenic Clostridium species

    • Identification of conserved features that could serve as targets for broad-spectrum inhibitors

    • Design of specific inhibitors targeting the EcfT-S-component interface or EcfT-EcfA/A' interface

  • Nutrient competition strategies:

    • Development of substrate analogs that competitively bind S-components without being transported

    • Engineering of EcfS components that sequester essential micronutrients in the environment

    • Design of "Trojan horse" compounds that are transported by ECF systems but exert antimicrobial effects inside cells

  • Diagnostic applications:

    • Identification of ECF transporter components as biomarkers for specific bacterial species

    • Development of diagnostic tools based on ECF transporter substrate utilization profiles

    • Creation of reporter systems to monitor ECF transporter activity in mixed microbial communities

The effectiveness of these approaches depends on several factors that warrant investigation:

  • The essentiality of specific ECF-transported substrates for pathogen survival

  • The structural conservation of EcfT across different bacterial species

  • The accessibility of conserved EcfT regions to small-molecule inhibitors

A methodological framework for ECF transporter-targeted antimicrobial discovery would include:

  • Comparative genomics to identify conserved and divergent features across species

  • High-throughput screening of compound libraries against reconstituted ECF transporters

  • Structure-based design of inhibitors targeting conserved interfaces

  • Validation in model systems progressing from in vitro to ex vivo and in vivo models

This research direction offers the potential for developing new antimicrobial strategies targeting essential nutrient acquisition systems, which may be less susceptible to traditional resistance mechanisms.

What are the most promising future research directions for C. kluyveri EcfT studies?

The study of C. kluyveri EcfT and associated ECF transporters represents a rich area for future research with implications spanning fundamental membrane transport mechanisms to applied biotechnology. Several key research directions emerge as particularly promising:

  • Integrated structural and functional characterization

    Despite advances in understanding ECF transporter architecture, significant knowledge gaps remain regarding the specific structural features of C. kluyveri EcfT and how these relate to its function. High-resolution structural studies combined with dynamic measurements will be crucial for elucidating the complete transport cycle and energy coupling mechanism. The recent technological advances in cryo-electron microscopy offer unprecedented opportunities to visualize ECF transporters in different conformational states .

  • Systems biology integration

    Understanding how ECF transporters fit within the broader metabolic network of C. kluyveri represents an important frontier. The remarkable capacity of C. kluyveri to produce medium-chain fatty acids like caproate likely depends on efficient micronutrient acquisition through specialized transport systems . Integrating transporter studies with metabolic modeling could reveal unexpected connections between nutrient acquisition and central metabolism.

  • Biotechnological applications

    The potential to engineer C. kluyveri strains with enhanced substrate uptake capabilities could significantly impact biotechnological applications, particularly in the production of valuable chemicals from renewable resources. The ability of C. kluyveri to convert ethanol and acetate into medium-chain fatty acids represents a promising platform for sustainable bioproduction . Optimizing nutrient uptake through ECF transporter engineering could enhance these processes.

  • Comparative and evolutionary studies

    Expanding research to compare ECF transporters across diverse Clostridium species could provide insights into how these transport systems have evolved to support different ecological niches and metabolic capabilities. This comparative approach may reveal adaptations specific to C. kluyveri's unusual metabolism and environmental conditions.

These research directions will benefit from interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational modeling. The continuing development of tools for genetic manipulation of Clostridium species will be particularly important for advancing functional studies in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.