Recombinant Clostridium kluyveri Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; CKL_1473; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Target Names
kdpC
Target Protein Sequence
MSTFFKGIKKPFLVTLVLLLVCGLAYPLILTGISQVIFPKQANGSLVIVNGKAIGSALIG QDFTDGRFMKGRPSAVNYNTYIREDKDSGNYAGVGSGSKNYAPTNPELVKRVQEDIDAFL KANPSIKKEDIPTDLLTASGSGLDPHISPESAAVQILALVKSTGLSKDKLETIVKNNTQG KAFGVFGEKTVNVLKVNLDIAKELGLFNKK
Uniprot No.

Target Background

Function

Recombinant Clostridium kluyveri Potassium-transporting ATPase C chain (kdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium into the cytoplasm. This subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function and genomic organization of the kdp system in Clostridium kluyveri?

The kdp system in C. kluyveri functions as a high-affinity potassium transport ATPase that allows the bacterium to adapt to low-potassium environments. Based on comparative genomic analysis with other Clostridium species, the C. kluyveri kdp gene region likely comprises several components including kdpA, kdpB, kdpC, and regulatory proteins KdpD and KdpE . In Clostridium acetobutylicum, a related species, the genomic organization includes two small open reading frames (orfZ and orfY), followed by kdpA, kdpB, kdpC, and kdpX genes, and then an operon encoding the sensor-effector regulatory proteins KdpD and KdpE . The kdpC gene specifically encodes the C chain component of this multi-subunit transport system.

How is kdp gene expression regulated in Clostridium species?

Expression of kdp genes in Clostridium species is inducible by low potassium concentrations in the environment . The regulation involves a two-component regulatory system consisting of KdpD (sensor kinase) and KdpE (response regulator) . In C. acetobutylicum, a transcription start point was mapped upstream of orfZ, and lowering the potassium content of the medium led to formation of a common transcript (orfZYkdpABCXDE) . Additionally, a promoter upstream of kdpD was found to be active only under non-inducing conditions, suggesting complex regulatory mechanisms .

What structural and functional domains characterize the kdpC protein?

The kdpC protein functions as the third subunit of the Kdp-ATPase complex, which is a P-type ATPase. While specific structural information for C. kluyveri kdpC is limited, research on kdp systems in other bacteria suggests that kdpC plays a crucial role in stabilizing the interaction between the catalytic KdpB subunit and the channel-forming KdpA subunit. The protein likely contains transmembrane domains that anchor it in the cell membrane where it participates in the potassium transport process.

What expression systems are most effective for producing recombinant C. kluyveri kdpC?

Based on successful expression of other C. kluyveri proteins, Escherichia coli expression systems are recommended for recombinant kdpC production . The methodology involves:

  • Amplifying the kdpC gene from C. kluyveri genomic DNA using PCR with specific primers containing appropriate restriction sites

  • Cloning the amplified gene into an expression vector (pET-based vectors are commonly used)

  • Transforming the recombinant plasmid into an E. coli expression strain (BL21(DE3) or its derivatives)

  • Inducing protein expression with IPTG under optimized conditions

For membrane-associated proteins like kdpC, specialized E. coli strains such as C41(DE3) or C43(DE3) may offer improved expression by better accommodating the potential toxicity of membrane protein overexpression.

What purification strategy yields the highest purity recombinant kdpC?

A multi-step purification approach is recommended for obtaining high-purity recombinant kdpC:

Table 1. Recommended Purification Protocol for Recombinant kdpC

Purification StepMethodPurposeConditions
Cell lysisSonication or French pressRelease protein from cellsIn buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 5% glycerol, protease inhibitors
Membrane isolationUltracentrifugationSeparate membrane fraction100,000×g, 1 hour, 4°C
SolubilizationDetergent treatmentExtract protein from membrane1% n-dodecyl-β-D-maltoside (DDM) or similar detergent
Affinity chromatographyIMAC (if His-tagged)Initial purificationImidazole gradient elution
Ion exchangeAnion exchangeRemove impuritiesBuffer pH 8.0
Size exclusionGel filtrationFinal polishingSuperdex 200 or similar

This protocol typically yields >95% pure protein suitable for functional and structural studies.

How can researchers verify the functional integrity of purified recombinant kdpC?

Functional assessment of recombinant kdpC should include:

  • ATP hydrolysis assay: When reconstituted with KdpA and KdpB, the complex should demonstrate ATPase activity

  • Potassium binding assay: Using isothermal titration calorimetry (ITC) or similar techniques to assess K+ interaction

  • Reconstitution into proteoliposomes: Measuring K+ transport activity when the complete Kdp complex is reconstituted

  • Circular dichroism (CD) spectroscopy: Verifying proper protein folding

Additionally, the purified protein can be assessed for stability under different buffer conditions to optimize storage and experimental procedures.

How can researchers design experiments to study the role of kdpC in bacterial adaptation to potassium limitation?

To investigate kdpC's role in potassium adaptation, researchers should implement a multi-faceted experimental approach:

  • Gene knockout studies: Create a ΔkdpC mutant in C. kluyveri and assess growth under varying potassium concentrations

  • Complementation assays: Reintroduce wild-type or mutated kdpC to verify phenotype restoration

  • Transcriptomics analysis: Examine gene expression changes in wild-type vs. ΔkdpC strains under potassium limitation

  • Potassium uptake measurements: Compare 86Rb+ (as K+ analog) uptake kinetics between wild-type and mutant strains

A well-designed experiment should include multiple potassium concentrations (e.g., 0.1, 0.5, 2, and 10 mM K+) and examine growth, transcription, and transport activity at various time points after shifting cells to low-potassium medium.

What structural analysis techniques are most informative for studying kdpC interactions with other Kdp system components?

For investigating structural interactions within the Kdp complex:

  • X-ray crystallography: Provides high-resolution structure of the kdpC protein alone or in complex

  • Cryo-electron microscopy: Particularly useful for the entire Kdp complex visualization

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies protein regions involved in interactions

  • Cross-linking coupled with mass spectrometry: Maps specific interaction sites between kdpC and other Kdp proteins

  • Molecular dynamics simulations: Predicts dynamic interactions based on available structural data

The choice of method depends on research questions, available facilities, and protein characteristics. A combination of complementary techniques often provides the most comprehensive understanding.

How does kdpC contribute to C. kluyveri's unique metabolic capabilities?

C. kluyveri possesses distinctive metabolic pathways for producing butyrate, caproate, and other organic acids from ethanol and acetate . The potential relationship between kdpC-mediated potassium transport and C. kluyveri metabolism can be investigated by:

  • Examining how potassium limitation affects production of chain-elongated carboxylic acids

  • Investigating whether kdpC expression correlates with changes in metabolic flux

  • Determining if knocking out kdpC affects the production of butyrate and caproate in ethanol/acetate fermentation

  • Testing whether potassium transport influences the co-culture dynamics between C. kluyveri and other organisms (such as Methanogen 166)

Table 2. Comparative Metabolite Production in Wild-type vs. Hypothetical ΔkdpC C. kluyveri under Different K+ Conditions

K+ ConcentrationStrainEthanol Consumption (mM)Acetate Consumption (mM)Butyrate Production (mM)Caproate Production (mM)
10 mMWild-type90-10075-8530-3535-45
10 mMΔkdpC85-9570-8028-3333-42
0.5 mMWild-type70-8055-6520-2525-35
0.5 mMΔkdpC30-4020-308-1210-15

Note: These values are hypothetical and would need to be determined experimentally

What are the critical parameters for optimizing kdpC expression in heterologous systems?

Successful recombinant expression of kdpC requires careful optimization of several parameters:

  • Expression temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction conditions: Low IPTG concentrations (0.1-0.5 mM) with extended expression time (overnight)

  • Media composition: Enriched media containing additional phosphate buffer and glycerol

  • Codon optimization: Adapting the C. kluyveri kdpC sequence for E. coli codon usage

  • Fusion tags: Testing various tags (His, MBP, SUMO) for improved solubility and expression

  • Cell lysis conditions: Gentle lysis methods to preserve protein structure

The optimal pH for enzymatic activity of other C. kluyveri proteins has been reported around pH 8.0, which may serve as a starting point for buffer optimization .

How can researchers resolve data discrepancies when studying kdpC function in different experimental systems?

When conflicting data arise across different experimental setups, researchers should systematically address potential sources of variation:

  • Strain differences: Compare genetic backgrounds of C. kluyveri strains (DSM 555 vs. others)

  • Experimental conditions: Standardize growth media, temperature, and atmospheric conditions

  • Protein preparation: Assess whether differences in protein purification affect activity

  • Functional assays: Test multiple assay systems and compare sensitivity and specificity

  • Statistical analysis: Apply appropriate statistical methods to determine significance of differences

  • Replication: Ensure sufficient biological and technical replicates

Implementation of blinded experimental designs and inter-laboratory validation can further strengthen confidence in resolving discrepancies.

What controls are essential for validating experimental results with recombinant kdpC?

Rigorous experimental design requires multiple controls:

  • Negative controls:

    • Empty vector-transformed E. coli

    • Heat-inactivated kdpC protein

    • kdpC with site-directed mutations in critical residues

  • Positive controls:

    • Well-characterized P-type ATPase (if available)

    • Native C. kluyveri membrane preparations

    • Recombinant kdpC from other bacterial species with known activity

  • System controls:

    • Assays conducted with varying K+ concentrations

    • Tests with related ions (Na+, Rb+) to confirm specificity

    • Time-course measurements to establish reaction kinetics

How does C. kluyveri kdpC differ from homologous proteins in other bacterial species?

Comparative analysis of kdpC across species reveals important evolutionary and functional insights:

A phylogenetic analysis of kdpC sequences would help position C. kluyveri within the broader evolutionary context of bacterial potassium transport systems.

How can researchers integrate kdpC studies with broader understanding of C. kluyveri's ecological roles?

C. kluyveri occupies a distinctive ecological niche with its ability to ferment ethanol and acetate to produce higher chain fatty acids . To connect kdpC function with this ecological context:

  • Examine kdpC expression and activity under conditions mimicking natural habitats

  • Investigate how potassium availability affects C. kluyveri's interactions with other microorganisms in co-culture systems

  • Determine whether kdpC function influences C. kluyveri's competitive fitness in mixed communities

  • Assess whether kdpC mutations affect adaptation to fluctuating environmental conditions

These studies would help position kdpC within the broader context of C. kluyveri's evolutionary adaptations and ecological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.