Recombinant Clostridium kluyveri Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; CKR_2392; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Clostridium kluyveri (strain NBRC 12016)
Target Names
lgt
Target Protein Sequence
MDPIAFSIGGFQIRWYGIMIALGVLAALILANLNCRYKGYNFDSLIDVFLISFPLAIIGA RVYYVVFQFQDYRNNLMDIFNIRLGGLAIHGGIIFGLGAAYIVSRYKKMDFIKLWDCFAP SIILGQAIGRWGNFFNGEAHGGIVGYEFISKFPLFIQRGMYINGDYYNPTFLYESLWDLI VCIILVYIFRKKHKRGTVICTYVGLYSLGRFFIEGLRTDSLMIGHIRVAQLVSFIGIVLS ISFFVYLKGRGKRVD
Uniprot No.

Target Background

Function

Recombinant Clostridium kluyveri Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: ckr:CKR_2392

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Clostridium kluyveri Lgt and what role does it play in bacterial membrane biology?

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis. In this reaction, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoproteins, forming a thioether bond. This modification is crucial for proper anchoring of lipoproteins to bacterial membranes, which subsequently affects cell envelope integrity and various cellular functions.

In C. kluyveri, as in other bacteria, Lgt-modified lipoproteins likely play vital roles in membrane stability, nutrient uptake, and potentially in the organism's unique metabolic capabilities such as caproic acid production . While experimental data specific to C. kluyveri Lgt is limited, we can infer from studies in E. coli that Lgt is essential for proper outer membrane biogenesis and maintaining membrane permeability barriers .

How can I clone and express recombinant C. kluyveri Lgt in heterologous systems?

Cloning and expressing C. kluyveri Lgt requires careful consideration of several factors due to its membrane-bound nature. The recommended methodological approach includes:

  • Gene identification and optimization: Identify the lgt gene sequence from the C. kluyveri genome (available in public databases) and optimize codon usage for your expression host.

  • Expression vector selection: Choose a vector with an inducible promoter (e.g., T7) and appropriate affinity tags (e.g., His6 or Strep-tag) for purification. Consider fusion partners that enhance membrane protein solubility.

  • Expression host selection: E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), are recommended as they can tolerate higher levels of membrane protein overexpression.

  • Induction conditions: Use lower temperatures (16-25°C) and reduced inducer concentrations to slow expression and facilitate proper membrane insertion.

  • Extraction optimization: Use mild detergents (DDM, LDAO) for efficient extraction from membranes while maintaining enzyme activity.

The key challenge will be maintaining the enzyme in a catalytically active form during purification, as demonstrated with E. coli Lgt where specific detergent conditions were critical for preserving activity .

What are the optimal buffer conditions for assaying recombinant C. kluyveri Lgt activity?

Based on assays developed for E. coli Lgt, the following buffer conditions would likely be suitable for C. kluyveri Lgt activity measurements:

ComponentRecommended RangeNotes
Buffer50-100 mM Tris-HCl or HEPESpH 7.5-8.0
Salt100-150 mM NaClMaintains protein stability
Detergent0.05-0.1% DDM or LDAOCritical for solubilization
Divalent Cations5-10 mM MgCl₂May enhance activity
Reducing Agent1-5 mM DTT or β-mercaptoethanolPrevents oxidation of cysteine residues
Phosphatidylglycerol50-200 μMLipid substrate
Peptide Substrate20-100 μM (e.g., Pal-IAAC)With conserved cysteine residue

The enzyme activity can be measured using the coupled luciferase reaction that detects glycerol phosphate release, which is a by-product of the Lgt-catalyzed transfer reaction, as demonstrated with E. coli Lgt . When adapting this assay for C. kluyveri Lgt, consider that the strict anaerobic nature of C. kluyveri may necessitate performing the assay under anaerobic conditions.

How does the substrate specificity of C. kluyveri Lgt compare to orthologs from other bacterial species?

While specific experimental data on C. kluyveri Lgt substrate specificity is not directly available, comparison with other bacterial Lgt enzymes suggests several important considerations:

  • Lipobox recognition: Like other Lgt enzymes, C. kluyveri Lgt likely recognizes the canonical lipobox motif [LVI][ASTVI][GAS][C], with the conserved cysteine residue being essential for modification.

  • Phospholipid preference: E. coli Lgt utilizes phosphatidylglycerol as the preferred donor substrate . Given C. kluyveri's anaerobic metabolism and unique membrane composition, its Lgt may have evolved to utilize slightly different phospholipid species or variants.

  • Signal peptide requirements: The signal peptide preceding the lipobox motif likely contains specific features that influence Lgt recognition efficiency. C. kluyveri, as a strict anaerobe with different membrane architecture than E. coli, may have evolved specific signal peptide preferences.

To experimentally determine C. kluyveri Lgt substrate specificity, researchers should:

  • Test the enzyme with synthetic peptides containing variations in the lipobox sequence

  • Compare activity with various phospholipid donors including phosphatidylglycerol from different sources

  • Investigate if the enzyme can modify heterologous prolipoproteins from both Gram-positive and Gram-negative bacteria

The substrate specificity findings would provide insights into both the evolutionary adaptation of Lgt in anaerobic bacteria and potential biotechnological applications.

What is the effect of Lgt inactivation on C. kluyveri cell envelope integrity and physiology?

Based on studies in E. coli, inactivation of Lgt in C. kluyveri would likely have significant effects on cell envelope integrity and physiology:

  • Membrane permeability: Lgt depletion in E. coli leads to increased outer membrane permeability . Similarly, C. kluyveri Lgt inactivation would likely compromise membrane integrity, though the exact phenotype may differ due to the different cell envelope architecture in Gram-positive and Gram-negative bacteria.

  • Lipoprotein processing: Unmodified prolipoproteins would accumulate, as observed in E. coli Lgt depletion experiments where unmodified pro-Lpp (UPLP) accumulated . This would disrupt proper lipoprotein localization and function.

  • Metabolic impacts: Given C. kluyveri's unique metabolic capabilities, such as the production of caproic acid from ethanol and acetate , Lgt inactivation may influence these pathways if key membrane transporters or enzymes are lipoproteins.

  • Stress sensitivity: As with E. coli, C. kluyveri with inactivated Lgt would likely show increased sensitivity to environmental stresses, potentially including sensitivity to oxygen given its strict anaerobic nature.

To experimentally investigate these effects, researchers could develop an inducible deletion strain of C. kluyveri lgt, similar to the approach used for E. coli , adapting the methodology for anaerobic conditions required by C. kluyveri.

What methods are most effective for purifying active recombinant C. kluyveri Lgt?

Purification of active recombinant C. kluyveri Lgt presents unique challenges due to its membrane-bound nature. Based on successful approaches with other bacterial Lgt proteins, the following methodological strategy is recommended:

  • Membrane fraction isolation:

    • Harvest cells expressing recombinant Lgt

    • Lyse cells using French press or sonication under anaerobic conditions

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Detergent solubilization optimization:

    • Screen detergents (DDM, LDAO, OG) at various concentrations (0.5-2%)

    • Incubate membrane fraction with selected detergent for 1-2 hours

    • Remove insoluble material by ultracentrifugation

  • Affinity chromatography:

    • Apply solubilized protein to appropriate affinity resin (Ni-NTA for His-tagged protein)

    • Include detergent at concentration above CMC in all buffers

    • Elute with imidazole gradient or other appropriate method

  • Further purification:

    • Size exclusion chromatography to separate detergent micelles and protein aggregates

    • Consider ion exchange chromatography for increased purity

  • Activity verification:

    • Perform enzymatic assay using the glycerol phosphate release method

    • Verify protein integrity by western blotting

Throughout purification, it is crucial to maintain anaerobic conditions when possible, as C. kluyveri is a strict anaerobe and its proteins may be oxygen-sensitive. Additionally, including stabilizing agents such as glycerol (10-20%) in purification buffers may help maintain enzyme activity.

How might C. kluyveri Lgt inhibition affect the organism's unique metabolic pathways?

C. kluyveri is known for its distinctive metabolic capabilities, particularly its ability to produce caproic acid and hexanol from ethanol and acetate or butyrate . Inhibition of Lgt could potentially impact these pathways through several mechanisms:

  • Membrane transporter functionality: If transporters involved in ethanol, acetate, or butyrate uptake are lipoproteins, their improper processing due to Lgt inhibition would disrupt substrate acquisition and metabolic flux.

  • Enzyme complexes: C. kluyveri contains enzyme complexes such as the ethanol dehydrogenase/acetaldehyde dehydrogenase complex that resides in microcompartments . If lipoprotein components are involved in the assembly or function of these complexes, Lgt inhibition would affect their activity.

  • Redox balance: C. kluyveri metabolism relies on proper electron flow, including ferredoxin-dependent reactions . Disruption of membrane-associated electron transport components could alter the organism's ability to maintain redox balance.

  • Stress response: The stress caused by improper lipoprotein processing might trigger adaptive responses that redirect metabolic flux away from caproate production toward stress tolerance mechanisms.

For experimental investigation, researchers could:

  • Compare metabolite profiles of wild-type C. kluyveri with an Lgt-depleted strain

  • Measure activities of key enzymes in central carbon metabolism under Lgt inhibition

  • Analyze transcriptomic and proteomic changes to identify affected pathways

  • Monitor caproate production rates and yields under partial Lgt inhibition

This research direction could provide insights not only into C. kluyveri physiology but also into potential metabolic engineering strategies for enhanced caproate production.

Could inhibitors effective against E. coli Lgt also target C. kluyveri Lgt, and what structural features would determine cross-species efficacy?

The potential cross-species efficacy of Lgt inhibitors depends on several structural and functional considerations:

  • Binding site conservation: The degree of sequence and structural conservation in the active site between E. coli and C. kluyveri Lgt would be the primary determinant of inhibitor cross-reactivity. Based on known bacterial Lgt structures, the phosphatidylglycerol binding site tends to be highly conserved .

  • Inhibitor mechanism: The identified E. coli Lgt inhibitors (G9066, G2823, G2824) demonstrated potent inhibition of Lgt biochemical activity in vitro (IC₅₀ values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively) . If these compounds target the conserved active site, they may also inhibit C. kluyveri Lgt.

  • Membrane penetration: As a Gram-positive bacterium, C. kluyveri lacks the outer membrane present in E. coli. This difference in cell envelope architecture could affect inhibitor access to the target enzyme, potentially enhancing efficacy against C. kluyveri if the compounds can more readily reach the cytoplasmic membrane.

  • Metabolic considerations: C. kluyveri's unique anaerobic metabolism may influence inhibitor efficacy through potential differences in efflux mechanisms or metabolic modification of the inhibitors.

To experimentally investigate cross-species inhibitor efficacy, researchers should:

  • Express recombinant C. kluyveri Lgt and test its sensitivity to known E. coli Lgt inhibitors in vitro

  • Perform structural modeling of C. kluyveri Lgt based on known Lgt structures to predict inhibitor binding

  • Test growth inhibition of C. kluyveri cultures with Lgt inhibitors under anaerobic conditions

  • Develop structure-activity relationship studies to identify inhibitor modifications that enhance activity against C. kluyveri Lgt

This research could contribute to the development of broad-spectrum antibacterial compounds targeting essential lipoprotein biosynthesis pathways.

What insights could structural studies of C. kluyveri Lgt provide about adaptation of this enzyme to anaerobic environments?

Structural studies of C. kluyveri Lgt could reveal important adaptations to anaerobic environments through several potential features:

  • Active site architecture: Anaerobic enzymes often contain modifications to accommodate different redox states. The active site of C. kluyveri Lgt might show adaptations that make it less susceptible to oxidative damage compared to aerobic counterparts.

  • Membrane interaction domains: As a strict anaerobe, C. kluyveri likely has a distinct membrane composition optimized for anaerobic environments. The membrane-interacting regions of Lgt may show adaptations for optimal function within this specific lipid environment.

  • Substrate channel design: The channels that guide substrates to the active site might contain features that enhance specificity for the particular prolipoproteins and phospholipids present in C. kluyveri.

  • Protein stability mechanisms: Proteins from strict anaerobes often contain specific stabilizing elements that maintain function under the particular constraints of anaerobic environments, such as altered ionic interactions or hydrophobic packing.

To conduct these structural studies, researchers should consider:

  • X-ray crystallography of purified C. kluyveri Lgt, which would require specialized anaerobic crystallization techniques

  • Cryo-electron microscopy of the enzyme in nanodiscs to capture it in a native-like membrane environment

  • Molecular dynamics simulations to compare behavior in different membrane environments

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions and substrate interaction sites

Comparing the resulting structures with Lgt from aerobic bacteria would provide valuable insights into how essential membrane enzymes adapt to different oxygen availability conditions, potentially informing both basic understanding of protein evolution and applied approaches to enzyme engineering.

How can recombinant C. kluyveri Lgt be utilized for in vitro lipoprotein synthesis and engineering?

Recombinant C. kluyveri Lgt offers unique potential for in vitro lipoprotein synthesis and engineering applications:

  • Production of modified lipoproteins: Purified active C. kluyveri Lgt could be used to modify recombinant prolipoproteins with various diacylglyceryl moieties in controlled in vitro reactions. This would allow for the production of lipoproteins with defined modifications for structural studies or therapeutic development.

  • Lipid substrate flexibility exploration: By testing C. kluyveri Lgt with various phospholipid donors, researchers could identify whether this enzyme accepts non-natural lipid substrates. This knowledge could enable the synthesis of lipoproteins with novel properties, such as fluorescent or clickable lipid moieties for tracking or functionalization.

  • Cell-free lipoprotein display systems: Coupling C. kluyveri Lgt with cell-free protein synthesis systems could enable the rapid production and display of lipidated proteins on synthetic liposomes or nanodiscs for applications such as vaccine development or enzyme immobilization.

The methodological approach would involve:

  • Establishing an in vitro reaction system with purified C. kluyveri Lgt

  • Optimizing reaction conditions including detergent type and concentration

  • Developing analytical methods to verify successful lipidation

  • Creating libraries of modified lipoproteins with various lipid anchors

This application could be particularly valuable for studying membrane proteins and developing novel biocatalysts with enhanced stability through lipid anchoring.

What role might C. kluyveri Lgt play in the organism's unique metabolic relationship with syntrophic partners?

C. kluyveri engages in syntrophic relationships with other microorganisms, particularly in coculture systems where it produces caproate from sugars via ethanol and acetate intermediates . The role of Lgt in these syntrophic relationships presents an intriguing research question:

  • Membrane adaptation: Proper lipoprotein processing by Lgt may be critical for C. kluyveri to adapt its membrane composition during coculture growth, optimizing for metabolite exchange with partners like C. acetobutylicum or C. saccharolyticum .

  • Signaling and recognition: Certain lipoproteins might be involved in signaling or recognition processes between C. kluyveri and its syntrophic partners. If so, Lgt would play an indirect role in establishing and maintaining these relationships.

  • Transport optimization: The exceptional caproate production observed in C. kluyveri cocultures (145-200 mM with production rates of 3.25-8.1 mM/h) may depend on proper lipoprotein-mediated transport systems that facilitate efficient nutrient and metabolite exchange.

  • Cell fusion mechanisms: The observed cell fusion events between C. acetobutylicum and C. kluyveri in cocultures might involve specific lipoproteins whose proper processing depends on Lgt activity.

To experimentally investigate this role, researchers could:

  • Compare lipoprotein profiles of C. kluyveri grown in monoculture versus coculture conditions

  • Assess the impact of partial Lgt inhibition on coculture performance and metabolite exchange

  • Identify lipoproteins specifically upregulated during successful syntrophic growth

  • Investigate whether cell fusion events depend on specific Lgt-processed lipoproteins

This research direction could reveal fundamental insights into microbial community interactions and potentially improve coculture-based biotechnological processes for caproate production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.