Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CKR_1028; UPF0756 membrane protein CKR_1028
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Clostridium kluyveri (strain NBRC 12016)
Target Names
CKR_1028
Target Protein Sequence
MESTIILIIILTASVLGRANSVALATCFLLILKLLNADKFIFPYLQENGLFLGLVILIAS ILIPIADGKVSYISIRNVFTSWLGIFALLVSLFTTYLSGLGMNYLTIQGHSEIMPALILG AVIAAAFLGGVPVGPMITSGLIALGLKLFNKIGS
Uniprot No.

Target Background

Database Links

KEGG: ckr:CKR_1028

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Clostridium kluyveri and what distinguishes it from other bacterial species?

Clostridium kluyveri is a member of the Clostridium genus, which comprises approximately 100 species of Gram-positive bacteria that include both common free-living bacteria and significant pathogens. C. kluyveri can be distinguished microscopically by its characteristic endospores, which have a distinctive bowling pin or bottle shape that differentiates them from other bacterial endospores that typically display an ovoid morphology. The organism is naturally found in soil environments and the intestinal tracts of various animals, including humans .

Unlike many pathogenic Clostridium species, C. kluyveri (strain NBRC 12016) serves as an important model organism for studying bacterial membrane proteins due to its unique metabolic capabilities and genetic accessibility. When conducting research with this organism, standard biosafety practices for BSL-1 organisms are typically sufficient, though institutional guidelines should always be consulted.

What is UPF0756 membrane protein CKR_1028 and why is it significant for research?

The UPF0756 membrane protein CKR_1028 from Clostridium kluyveri is classified as an uncharacterized protein family (UPF) membrane protein. The "UPF" designation indicates that while the protein has been identified, its precise biological function remains to be fully elucidated . This protein is encoded within the C. kluyveri genome (strain NBRC 12016) and has been assigned the UniProt accession number B9E0Q4 .

The scientific significance of studying UPF0756 membrane protein CKR_1028 lies in understanding novel membrane protein structures and functions, expanding our knowledge of bacterial membrane biology. Membrane proteins represent approximately 30% of all proteins in most organisms and constitute over 60% of drug targets, making their study crucial for both basic science and translational research. The investigation of uncharacterized proteins like CKR_1028 may reveal novel structural motifs, unique functional mechanisms, or unexpected metabolic pathways that could significantly advance our understanding of bacterial physiology.

How does the recombinant expression system affect the properties of CKR_1028?

The expression system selected for producing recombinant CKR_1028 can significantly impact the protein's properties, including folding, post-translational modifications, and functional activity. Based on available information, the recombinant CKR_1028 protein is typically sourced from yeast expression systems .

The expression host choice follows a methodological approach based on protein complexity. While bacterial systems like E. coli offer rapid growth and high protein yields, they may not properly fold complex membrane proteins. Yeast expression systems provide several advantages for membrane protein production:

  • Eukaryotic protein processing machinery

  • Ability to perform post-translational modifications

  • Compatibility with membrane protein folding

  • Cost-effectiveness compared to mammalian systems

  • Scalable production potential

What are the optimal conditions for reconstitution and storage of recombinant CKR_1028?

For optimal reconstitution of lyophilized recombinant CKR_1028, the protein should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial. The recommended reconstitution involves using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

For long-term storage stability, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard practice for many laboratories. Following reconstitution and glycerol addition, the protein solution should be aliquoted to avoid repeated freeze-thaw cycles and stored at -20°C or preferably -80°C .

The shelf life varies based on multiple factors including:

  • Storage temperature (-80°C provides greater longevity than -20°C)

  • Buffer composition

  • Presence of stabilizing agents

  • Intrinsic stability of the protein

Generally, liquid formulations maintain stability for approximately 6 months at -20°C/-80°C, while lyophilized forms remain stable for up to 12 months at the same temperatures . Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and aggregation.

What expression strategies maximize yield and functionality of membrane proteins like CKR_1028?

Optimizing expression of membrane proteins such as CKR_1028 requires a systematic approach rather than the traditional "trial and error" methods that often yield disappointing results . A rationalized strategy should consider:

  • Host Selection:

    • For CKR_1028, yeast systems have proven effective

    • Alternative systems include E. coli, insect cells, and mammalian cells depending on required post-translational modifications and functional requirements

  • Vector Design:

    • Inducible promoters to control expression timing

    • Signal sequences optimized for membrane targeting

    • Fusion tags that aid in membrane insertion without compromising function

    • Codon optimization for the selected host

  • Expression Conditions:

    • Lower induction temperatures (often 16-25°C) to slow protein synthesis and allow proper folding

    • Reduced inducer concentrations to prevent overwhelming the membrane protein insertion machinery

    • Extended expression times to accumulate properly folded protein

  • Membrane-mimetic environments:

    • Addition of specific lipids or detergents to culture media

    • Co-expression of chaperones specific to membrane proteins

The table below summarizes key parameters for optimizing membrane protein expression:

ParameterStandard ConditionOptimization for Membrane Proteins
Temperature37°C (E. coli), 30°C (yeast)16-25°C
Inducer concentration0.5-1.0 mM IPTG (E. coli)0.1-0.2 mM IPTG
Expression time3-5 hours16-24 hours
Media supplementsNoneSpecific lipids, mild detergents
Chaperone co-expressionNoneFtsH, YidC, SecYEG complex

By carefully controlling these parameters and understanding the protein insertion and folding pathways specific to membrane proteins, researchers can significantly improve yield and functionality compared to conventional approaches .

What purification challenges are specific to CKR_1028 and how can they be addressed?

Membrane proteins like CKR_1028 present unique purification challenges distinct from soluble proteins. Several methodological approaches can address these specific issues:

  • Extraction from Membranes:

    • Selection of appropriate detergents is crucial - start with mild detergents like DDM, LMNG, or digitonin

    • Optimize detergent-to-protein ratio to prevent protein aggregation while ensuring efficient extraction

    • Consider membrane disruption methods (sonication vs. homogenization) based on expression host

  • Maintaining Stability During Purification:

    • Incorporate lipids or lipid-like molecules (bicelles, nanodiscs) to maintain native-like environment

    • Add stabilizing agents such as glycerol (5-50%) throughout purification steps

    • Maintain strict temperature control (typically 4°C) during all handling

  • Chromatography Considerations:

    • For histidine-tagged CKR_1028, use detergent in IMAC buffers above critical micelle concentration

    • Size exclusion chromatography can separate protein-detergent complexes from empty micelles

    • Ion exchange chromatography parameters must account for altered surface charge distribution in detergent-solubilized state

  • Purity Assessment:

    • SDS-PAGE analysis should achieve >85% purity for most research applications

    • Consider native PAGE or blue native PAGE to verify oligomeric state

    • Mass spectrometry with detergent-compatible protocols for definitive identification

A rational purification strategy should be documented in detail, with careful monitoring of protein stability and function throughout each step. For CKR_1028 specifically, researchers should be aware that as a partial-length recombinant protein , certain structural elements may be missing, potentially affecting solubility and stability during purification.

How can structural analysis of CKR_1028 contribute to understanding bacterial membrane organization?

Structural characterization of UPF0756 membrane protein CKR_1028 represents an opportunity to expand our understanding of bacterial membrane protein folding and organization. This addresses a significant knowledge gap, as UPF (Uncharacterized Protein Family) members often reveal novel structural motifs and functional mechanisms.

Methodological approaches for structural analysis include:

  • X-ray Crystallography:

    • Requires detergent screening to identify conditions that maintain native structure while allowing crystal formation

    • Lipidic cubic phase crystallization often proves superior for membrane proteins

    • Resolution of 3.5Å or better would provide insights into secondary structure elements and potential functional domains

  • Cryo-Electron Microscopy:

    • Particularly valuable if CKR_1028 forms oligomeric complexes

    • Can visualize the protein in more native-like lipid environments using nanodiscs or reconstituted liposomes

    • Recent advances allow near-atomic resolution for membrane proteins >100 kDa

  • Solution NMR:

    • Applicable if CKR_1028 can be isotopically labeled (13C, 15N)

    • Provides dynamic information not available from static structures

    • May require deuteration and TROSY techniques for size limitations

  • Computational Analysis:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to predict membrane interactions

    • Integration with experimental data for model refinement

The structural insights gained could reveal:

  • Potential involvement in beta-barrel assembly pathways similar to those described for Gram-negative bacteria

  • Novel membrane protein folding mechanisms specific to Clostridium species

  • Structural motifs that could indicate function in transport, signaling, or membrane organization

Correlation of structural features with genomic context in C. kluyveri could further illuminate the protein's role in bacterial physiology and potentially identify novel drug targets in related pathogenic species.

What functional assays can be employed to characterize the biological role of CKR_1028?

Since CKR_1028 belongs to an uncharacterized protein family (UPF0756), determining its biological function requires a multi-faceted approach combining biochemical, genetic, and computational methods:

  • Genetic Manipulation Studies:

    • Gene knockout or knockdown using CRISPR-Cas9 or antisense RNA in C. kluyveri

    • Phenotypic analysis under various growth conditions

    • Complementation studies to confirm phenotype specificity

    • Conditional expression systems to study essential functions

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with antibodies against CKR_1028

    • Bacterial two-hybrid or split-GFP assays to identify interaction partners

    • Proximity labeling approaches (e.g., BioID) adapted for bacterial systems

    • Cross-linking mass spectrometry to capture transient interactions

  • Localization Studies:

    • Fluorescent protein fusions to determine subcellular localization

    • Immunogold electron microscopy for high-resolution localization

    • Fractionation studies with Western blot analysis

    • Super-resolution microscopy to examine dynamic behavior

  • Functional Biochemical Assays:

    • Liposome reconstitution to test for transport activity

    • Enzyme activity assays based on predicted functional domains

    • Lipid binding assays to assess membrane interaction specificity

    • Structural changes upon binding potential substrates or interaction partners

The table below outlines key assays and their respective information yield:

Assay TypeTechnical ApproachInformation Obtained
Gene FunctionCRISPR knockoutEssential nature and gross phenotypic effects
Protein InteractionsCo-IP/Mass SpecIdentification of protein complexes
Membrane DynamicsFRAP with GFP fusionMobility and membrane domain association
Transport FunctionLiposome flux assaysSubstrate specificity and kinetics
Structure-FunctionSite-directed mutagenesisCritical residues for activity

By systematically applying these methodologies, researchers can develop testable hypotheses about CKR_1028's function and place it within the broader context of C. kluyveri physiology.

How does CKR_1028 compare to homologous proteins in other bacterial species?

Comparative analysis of CKR_1028 with homologous proteins provides evolutionary context and potential functional insights. This approach involves:

  • Sequence-Based Comparisons:

    • BLAST and HMMER searches against bacterial protein databases

    • Multiple sequence alignments to identify conserved residues

    • Analysis of conservation patterns in different bacterial lineages

    • Identification of conserved domains or motifs

  • Structural Homology:

    • Structural prediction using AlphaFold2 or RoseTTAFold

    • Comparison with solved structures in the Protein Data Bank

    • Analysis of predicted transmembrane topology across homologs

    • Conservation mapping onto structural models

  • Genomic Context Analysis:

    • Examination of gene neighborhoods across species

    • Identification of conserved operonic structures

    • Correlation with metabolic pathways specific to different bacteria

    • Co-evolution patterns with other genes

  • Functional Comparison:

    • Literature mining for characterized homologs

    • Integration of experimental data from related proteins

    • Cross-species complementation experiments

    • Correlation of presence/absence with specific bacterial phenotypes

Through these approaches, researchers might discover that CKR_1028 belongs to a wider family of membrane proteins with specific functions in bacterial membrane organization or biogenesis. For instance, it may share structural similarities with components involved in protein assembly machinery like the Bam complex in Gram-negative bacteria , though serving a distinct function in the Gram-positive Clostridium membrane.

The evolutionary conservation pattern could reveal whether CKR_1028 represents an ancient bacterial protein or a more recent adaptation specific to Clostridium and related genera, providing clues to its biological significance.

What are common challenges in experimental reproducibility when working with CKR_1028?

Experimental reproducibility with membrane proteins like CKR_1028 presents several systematic challenges that researchers should anticipate and address methodically:

  • Expression Variability:

    • Batch-to-batch variation in expression systems

    • Cell density effects on membrane protein processing

    • Inducer concentration inconsistencies

    • Temperature fluctuations during expression

  • Protein Stability Issues:

    • Degradation during purification

    • Aggregation upon storage or buffer exchange

    • Oxidation of critical residues

    • Detergent-induced conformational changes

  • Functional Assay Variability:

    • Lipid composition effects on reconstituted systems

    • Buffer component interactions with the protein

    • Instrument calibration differences between laboratories

    • Reagent quality variations

To address these challenges, implement these methodological approaches:

  • Establish detailed standard operating procedures with precise parameters

  • Prepare larger, uniform batches of protein for extended study series

  • Include positive controls in each experimental set

  • Validate critical results using orthogonal methods

  • Document all lot numbers of reagents and materials

  • Monitor protein quality before each experiment using analytical SEC or DLS

Using the recombinant CKR_1028 with >85% purity as verified by SDS-PAGE provides a starting point, but researchers should implement additional quality control steps to ensure consistency across experiments.

How can researchers optimize membrane protein-specific techniques for studying CKR_1028?

Optimizing membrane protein-specific techniques for CKR_1028 research requires adaptation of standard protocols to accommodate the unique properties of membrane proteins:

  • Solubilization Optimization:

    • Systematic detergent screening using a panel of 8-12 detergents

    • Detergent concentration gradient analysis

    • Time and temperature optimization for extraction

    • Solubilization efficiency assessment by Western blot

  • Reconstitution Strategies:

    • Lipid composition screening (native vs. synthetic mixtures)

    • Protein-to-lipid ratio optimization

    • Reconstitution method comparison (dialysis vs. direct dilution)

    • Functional validation of reconstituted protein

  • Biophysical Characterization Adaptations:

    • Circular dichroism with specialized detergent-compatible cuvettes

    • Thermostability assays in the presence of lipids or detergents

    • Surface plasmon resonance with captured liposomes or nanodiscs

    • Modified protocols for mass spectrometry of membrane proteins

  • Crystallization Approaches:

    • Lipidic cubic phase methods

    • Antibody fragment co-crystallization

    • Fusion protein strategies

    • Systematic sparse matrix screening with detergent variation

The table below provides optimization parameters for key techniques:

TechniqueStandard ProtocolMembrane Protein Adaptation
SDS-PAGEStandard Laemmli methodSample not boiled, 37°C incubation
Western BlotPVDF membraneExtended transfer times, low SDS
Mass SpectrometryTrypsin digestionChymotrypsin or alternative proteases
Circular DichroismStandard cuvettes0.01-0.05 cm pathlength cells
SECAqueous buffersDetergent above CMC in all buffers

What considerations should be made when designing mutagenesis studies for CKR_1028?

Designing effective mutagenesis studies for membrane proteins like CKR_1028 requires special considerations beyond those for soluble proteins:

  • Target Selection Strategy:

    • Prioritize conserved residues identified through multiple sequence alignments

    • Focus on predicted transmembrane regions and membrane-water interfaces

    • Consider charged residues within transmembrane segments (often functionally critical)

    • Examine genomic context for co-evolved residues that may have functional relationships

  • Mutation Design Principles:

    • Conservative substitutions to maintain membrane insertion (e.g., Leu→Ile, Phe→Tyr)

    • Alanine scanning for initial functional mapping

    • Charge reversals for potential salt bridge identification

    • Cysteine substitutions for accessibility and cross-linking studies

  • Expression and Stability Considerations:

    • Validate proper membrane insertion of each mutant

    • Compare expression levels to wild-type protein

    • Assess protein stability in detergent solutions

    • Monitor oligomeric state changes using BN-PAGE

  • Functional Analysis Framework:

    • Develop quantitative assays for each suspected function

    • Compare kinetic parameters rather than single-point measurements

    • Correlation of structural perturbations with functional effects

    • Temperature sensitivity studies to identify destabilizing mutations

When working with a partially characterized protein like CKR_1028, it is particularly important to design mutations that can test multiple hypotheses about function. For example, if transport activity is suspected, mutations in potential substrate binding sites and along the transport path should be prioritized. If protein-protein interactions are being investigated, interface residues predicted by computational methods would be primary targets.

Documentation should include detailed protocols and raw data for all mutants, even those showing no phenotype, as these negative results can be informative for developing refined hypotheses about protein function.

How might CKR_1028 contribute to understanding bacterial membrane biogenesis?

The study of CKR_1028 as an uncharacterized membrane protein offers significant potential to expand our understanding of membrane biogenesis in Gram-positive bacteria like Clostridium kluyveri. Several research directions can connect this protein to broader membrane biology concepts:

  • Potential Role in Protein Assembly:

    • Investigation of CKR_1028 as a possible component of protein insertion machinery

    • Comparison with known assembly systems like the Bam complex in Gram-negative bacteria

    • Analysis of potential chaperoning functions for other membrane proteins

    • Examination of protein-lipid interactions that might facilitate membrane protein folding

  • Membrane Architecture Contributions:

    • Assessment of CKR_1028's role in maintaining membrane domain organization

    • Potential involvement in cell division through membrane remodeling

    • Possible function in membrane stress responses

    • Investigation of lipid composition regulation

  • Evolutionary Perspective:

    • Comparison with membrane proteins in diverse bacterial phyla

    • Analysis of potential horizontal gene transfer events

    • Examination of co-evolution with other membrane components

    • Reconstruction of the evolutionary history of UPF0756 family proteins

  • Systems Biology Integration:

    • Network analysis placing CKR_1028 in the context of membrane-associated processes

    • Transcriptomic studies to identify co-regulated genes

    • Metabolomic analyses to correlate membrane composition with CKR_1028 function

    • Multi-omics integration to develop comprehensive models of membrane biogenesis

These research directions could significantly advance our understanding of bacterial membrane biology while revealing the specific functions of this uncharacterized protein. The findings may have broader implications for biotechnology applications and potentially for developing new antimicrobial strategies targeting membrane biogenesis in pathogenic Clostridium species.

What advanced structural biology approaches could reveal CKR_1028's functional mechanisms?

Cutting-edge structural biology methodologies can provide unprecedented insights into CKR_1028's functional mechanisms:

  • Time-Resolved Structural Studies:

    • Serial femtosecond crystallography at X-ray free-electron lasers

    • Time-resolved cryo-EM to capture conformational states

    • Temperature-jump NMR to observe dynamic transitions

    • Single-molecule FRET to track conformational changes in real-time

  • In Situ Structural Analysis:

    • Cellular cryo-electron tomography to visualize the protein in its native context

    • In-cell NMR to observe structural dynamics in living cells

    • Mass photometry of membrane extracts to analyze native complexes

    • Correlative light and electron microscopy for functional-structural integration

  • Hybrid Methodological Approaches:

    • Integration of crosslinking mass spectrometry with cryo-EM

    • Molecular dynamics simulations constrained by experimental data

    • EPR distance measurements combined with computational modeling

    • Hydrogen-deuterium exchange mass spectrometry with structural modeling

  • Functional Structure Analysis:

    • Site-specific infrared spectroscopy of active sites during function

    • Voltage-clamp fluorometry if transport or channel activity is present

    • Native mass spectrometry to identify bound cofactors or substrates

    • Solid-state NMR to examine lipid-protein interactions critical for function

The combination of these approaches could reveal:

  • Conformational changes associated with potential substrate binding

  • Interaction interfaces with other membrane components

  • Structural elements that determine membrane topology

  • Dynamic properties essential for function

These advanced structural studies are technically challenging but offer the potential to definitively characterize the molecular mechanisms of this uncharacterized protein, potentially revealing novel principles of membrane protein function.

How can computational approaches enhance experimental studies of CKR_1028?

Computational methods serve as powerful complements to experimental investigations of CKR_1028, enabling hypothesis generation and data interpretation:

  • Structure Prediction and Analysis:

    • AlphaFold2 or RoseTTAFold for atomic-level structural models

    • Molecular dynamics simulations in explicit membrane environments

    • Elastic network models to predict functionally relevant motions

    • Computational docking to identify potential ligands or interaction partners

  • Functional Annotation Methods:

    • Machine learning approaches trained on characterized membrane proteins

    • Gene neighborhood analysis across diverse bacterial genomes

    • Protein-protein interaction network prediction

    • Identification of conserved structural motifs linked to known functions

  • Systems-Level Integration:

    • Genome-scale metabolic models incorporating membrane processes

    • Protein-lipid interaction simulations

    • Coarse-grained models of membrane dynamics

    • Multi-scale simulations connecting molecular events to cellular phenomena

  • Experimental Design Optimization:

    • In silico mutagenesis to prioritize experimental targets

    • Virtual screening to identify potential inhibitors or activators

    • Simulation-guided protein engineering for enhanced stability

    • Bayesian experimental design for efficient parameter exploration

The integration of computational and experimental approaches creates a powerful research cycle:

  • Computational predictions guide targeted experiments

  • Experimental data validate and refine computational models

  • Refined models generate new hypotheses

  • New hypotheses drive the next round of experiments

This iterative process can accelerate the characterization of CKR_1028 significantly compared to either approach alone, providing a comprehensive understanding of this membrane protein's structure, function, and biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.