Recombinant Clostridium novyi Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role

CobS facilitates the condensation of adenosylcobinamide-GDP and α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate, a precursor to active vitamin B₁₂ . This reaction is essential for microbial cobalamin-dependent metabolism, including methionine synthesis .

Cobalamin Biosynthesis Studies

  • Pathway Elucidation: CobS is used to reconstitute the nucleotide loop assembly pathway in vitro, enabling mechanistic studies of cobalamin synthesis .

  • Enzyme Kinetics: Purified recombinant CobS allows precise characterization of substrate specificity and catalytic efficiency .

Vaccine Development

  • Antigen Production: Recombinant CobS is a candidate for subunit vaccines targeting C. novyi infections in livestock .

  • Epitope Mapping: Immunoinformatics approaches have identified CobS-derived B-cell epitopes for multi-valent vaccine design .

Industrial Biotechnology

  • Cobalamin Production: Engineered E. coli expressing CobS can optimize microbial B₁₂ synthesis for industrial applications .

Comparative Functional Studies

CobS homologs across species share conserved roles in cobalamin biosynthesis but differ in membrane association and substrate handling:

OrganismFunctionKey Finding
Salmonella typhimuriumSynthesizes adenosylcobalamin-5′-phosphate CobS activity requires liposome-enhanced membrane mimicry for optimal function .
Clostridium novyiLikely analogous pathway; role in pathogenicityRecombinant CobS enables study without culturing pathogenic strains .

Key Research Findings

  1. In Vitro Assembly: CobS, combined with CobU and CobT, synthesizes adenosylcobalamin-5′-phosphate from adenosylcobinamide and GTP .

  2. Membrane Association: CobS activity is enhanced in liposomal systems, suggesting physiological membrane dependency .

  3. Vaccine Potential: CobS is listed among antigens for engineered vaccines against C. novyi infections in livestock .

Future Directions

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve CobS’s 3D structure.

  • Therapeutic Exploration: Evaluate CobS as a target for anti-clostridial drugs.

  • Synthetic Biology: Optimize CobS for industrial cobalamin production via metabolic engineering.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know and we will prioritize development according to your specification.
Synonyms
cobS; NT01CX_2079; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Clostridium novyi (strain NT)
Target Names
cobS
Target Protein Sequence
MKNLILMIQFFTRIPINIEIDVKEDSFAKGISYLPLVGLIIGGFNAIVYFVSSKFILGTL PIVLALLANTIITGAFHIDGLADTCDGIFSSRKKERMLEIMKDSRVGTNGAIAIVFDFML RYAVLNSLNKKYIIIALILSPVVAKTVVTLLMCFSVYARKEGGLGGVFVGKVKPFRVIVA FIISISIGYVLIGYKYVALLLITVLFIEIYKKLIYSKIDGMTGDTLGAANEIAEIIFMLA LLSFKGCGLL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the two-step reaction of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.