Recombinant Clostridium novyi Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role and Mechanism

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, a critical step in bacterial lipoprotein biosynthesis . This modification anchors lipoproteins to the membrane, essential for membrane integrity and virulence in pathogenic bacteria .

Key Features:

  • Substrate Specificity: Requires phosphatidylglycerol as the lipid donor and a conserved cysteine in the prolipoprotein signal peptide .

  • Essentiality: Lgt is indispensable for bacterial growth, as shown in E. coli depletion studies .

Homology with Clostridial Toxins

Lgt enzymes share structural similarities with large clostridial toxins (LCTs) such as C. difficile Toxin B and C. sordellii lethal toxin . Key parallels include:

  • GT-A Fold: A Rossmann-like nucleotide-binding domain for UDP-glucose interaction .

  • Catalytic Residues: Asp-X-Asp (DXD) motifs and conserved asparagines (e.g., Asn293 in Legionella Lgt1) critical for glycosyltransferase activity .

FeatureLgt EnzymesClostridial Toxins
Structural DomainGT-A fold (Rossmann-like)GT-A fold (with CROP repeats)
Catalytic MechanismRetaining mechanismRetaining mechanism
Key ResiduesDXD motif, Asn293/Asn499 DXD motif, Gln189/Asn384

Recombinant Expression and Applications

While no studies explicitly describe recombinant C. novyi Lgt, related clostridial Lgt homologs have been engineered:

  • Clostridium kluyveri Lgt: Recombinant His-tagged Lgt (1–255 aa) expressed in E. coli .

  • Legionella pneumophila Lgt1: Crystal structures (PDB: 3JSZ) reveal UDP-glucose binding and catalytic states .

Functional Implications:

  • Antimicrobial Targets: Lgt inhibitors (e.g., macrocycles G2823/G2824) show bactericidal activity against E. coli, suggesting potential for broad-spectrum antibiotics .

  • Biotechnological Tools: Engineered Lgt variants could enable site-specific lipid modification of recombinant proteins.

Research Gaps and Future Directions

  • C. novyi-Specific Data: No direct studies on C. novyi Lgt exist in the reviewed literature. Comparative genomics or heterologous expression studies are needed.

  • Therapeutic Potential: C. novyi-NT (a non-toxic strain) is used in oncotherapy , but its Lgt’s role in tumor colonization remains unexplored.

Table 1: Conserved Residues in Lgt Enzymes

OrganismCritical ResiduesFunction
E. coli Y26, N146, G154Catalytic activity
Legionella Lgt1 D246, D248, N293UDP-glucose binding, catalysis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
lgt; NT01CX_0143; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Clostridium novyi (strain NT)
Target Names
lgt
Target Protein Sequence
MNPVAFEIFGLEIRWYGILICMGIILAYGLAYKRSKIYNIDFDKLTDVFIVALPFSILCA RLYYVIFNWSYYGANPSHILYIREGGLAIHGGLIGAVISGYLMSRYRKLNFLDLIDTVAP CFILAQAIGRWGNFFNSEAHGGIVSYEFISHFPKFIQNGMYIDGFYYHPTFLYESIWNIV VLIILLLITRKHLAKGSIFYLYLIFYSLGRFFIEGLRTDSLMLGSLRMAQVISLVFIILG IILIIKSNIKNKSTFKQ
Uniprot No.

Target Background

Function

Recombinant Clostridium novyi Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first critical step in bacterial lipoprotein biogenesis. This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to a peptide substrate, specifically targeting a conserved cysteine residue in prolipoprotein sequences via formation of a thioether bond . This post-translational modification is essential for proper membrane anchoring of bacterial lipoproteins, which play crucial roles in bacterial growth, pathogenesis, and maintenance of cell envelope integrity . The reaction catalyzed by Lgt releases glycerol phosphate as a by-product, which has been utilized in biochemical assays to measure Lgt activity .

When using phosphatidylglycerol containing a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released during the reaction, allowing for detection through coupled enzymatic assays . The conserved nature of this enzyme across bacterial species makes it a potential broad-spectrum antibacterial target.

How does Lgt depletion affect bacterial cell envelope integrity?

Lgt depletion has significant consequences for bacterial cell envelope integrity, as demonstrated in studies with uropathogenic Escherichia coli and other Gram-negative bacteria. The effects include:

Table 1: Consequences of Lgt Depletion on Bacterial Cell Envelope

EffectObservationExperimental Evidence
Outer membrane permeabilizationIncreased sensitivity to antibiotics and serum killingDemonstrated in clinical uropathogenic E. coli
Morphological changesOuter membrane blebbing and increased cell sizeVisualized microscopically in E. coli
Impaired lipoprotein functionDefective peptidoglycan-lipoprotein linkageReduction in peptidoglycan-linked Lpp forms
Growth inhibitionBactericidal effectObserved in both E. coli and A. baumannii

When Lgt is depleted or inhibited, proper processing of lipoproteins like Lpp (major outer membrane lipoprotein) and Pal is prevented . This disrupts the structural integrity of the cell envelope, particularly affecting the connections between the outer membrane and peptidoglycan layer. Unlike other steps in lipoprotein biosynthesis, deletion of the lpp gene does not rescue growth after Lgt depletion, indicating that the consequences of Lgt inhibition extend beyond effects on a single lipoprotein .

What makes Clostridium novyi unique among bacteria being investigated for therapeutic applications?

Clostridium novyi possesses several unique characteristics that make it particularly promising for therapeutic applications, especially in cancer treatment:

Clostridium novyi is a motile, gram-variable bacterium with a biphasic life cycle that includes a proliferative, lytically capable vegetative form and a more "dormant" sporulated form . Its key distinguishing features include:

  • Sophisticated oxygen sensitivity: The vegetative form is an ultra-sensitive obligate anaerobe that cannot survive in virtually any level of oxygen, while the spore form can survive in atmospheric oxygen but cannot germinate until an adequately hypoxic environment is located .

  • Tumor-seeking ability: C. novyi spores demonstrate metabolic activity that allows them to sense and chemotax toward hypoxic/acidic gradients, as typically found in solid tumors . This enables precise targeting of tumors while sparing normal tissues.

  • Direct and indirect oncolytic capabilities: C. novyi is one of the few bacterial species capable of both direct and indirect oncolysis, combined with potent recruitment of the immune system due to its gram variability .

  • Genetic tractability: Recent advances have demonstrated the efficacy of CRISPR/Cas9 gene insertion in C. novyi, opening opportunities for genetic engineering to enhance therapeutic properties .

The attenuated strain C. novyi-NT (created through heat treatment causing the loss of phage DNA encoding α-toxin) has shown promising results in preclinical and clinical trials with minimal systemic toxicity . Studies have demonstrated that 95% of murine subjects showed tumor mitigation after intravenous delivery of C. novyi-NT spores .

What are the technical requirements for culturing Clostridium novyi in a laboratory setting?

Culturing Clostridium novyi presents significant technical challenges due to its strict anaerobic requirements. The following methodological approach is necessary:

Table 2: Technical Requirements for C. novyi Culture

ParameterSpecificationMethodological Notes
Growth mediumReinforced Clostridial Media (RCM)38 g/1 L nanopure water
Anaerobic systemsAtmospheric chamber or oxygen-fixing enzymeBoth approaches validated for C. novyi culture
Media preparationAutoclaving followed by oxygen purgingWater bath pulse sonication for 90 minutes
Working environmentSealed glovebag purged with carbon dioxideTyvek seam tape used for sealing
Media dispensingAseptic technique within anaerobic chamberTransfer to sterile conical tubes
Oxygen monitoringContinuous monitoring recommended<0.1 ppm O₂ for vegetative growth

The experimental procedure involves preparing RCM according to manufacturer's instructions, followed by autoclaving . Critical to success is the thorough purging of oxygen through water bath pulse sonication for 90 minutes before sealing for immediate use within a benchtop atmospheric chamber . Media must be aseptically aliquoted into sterile conical tubes within a sealed, carbon dioxide-purged glovebag before inoculation .

These precise techniques are essential due to C. novyi's nature as an ultra-sensitive obligate anaerobe in its vegetative form. Researchers should implement rigorous oxygen exclusion protocols throughout all experimental procedures involving C. novyi.

What methodological approaches can be used to express and purify recombinant Lgt from Clostridium novyi?

While the search results don't directly address recombinant expression of Lgt from C. novyi, methodological approaches can be extrapolated from studies of E. coli Lgt and C. novyi culture requirements:

Table 3: Methodological Framework for Recombinant C. novyi Lgt Expression

StageApproachMethodological Considerations
Gene isolationPCR amplification from C. novyi genomic DNAMust be performed under strict anaerobic conditions
Expression systemHeterologous expression in E. coli or anaerobic expression systemE. coli system would require codon optimization
Protein extractionDetergent-based membrane protein solubilizationSelection of detergent critical for maintaining activity
Activity verificationGlycerol phosphate release assayAs described for E. coli Lgt, measuring G1P/G3P release
Functional validationComplementation of E. coli lgt depletion strainCRISPRi technology can be used to create depletion strains

For expression validation, researchers can utilize the coupled luciferase reaction described for E. coli Lgt that detects released G3P as Lgt catalyzes the reaction . Sensitivity to Lgt inhibitors (such as G9066, G2823, and G2824 identified for E. coli Lgt) could be used to confirm proper folding and activity of the recombinant protein .

Considering C. novyi's strict anaerobic nature, protein expression, purification, and activity assays would need to be performed under anaerobic conditions, potentially using methods similar to those described for C. novyi culture (atmospheric chamber or oxygen-fixing enzymes) .

How could researchers evaluate potential inhibitors of C. novyi Lgt in an experimental setting?

A systematic approach to evaluating C. novyi Lgt inhibitors would include:

  • Biochemical assay adaptation: Modify the glycerol phosphate release assay used for E. coli Lgt to accommodate C. novyi Lgt's potentially different substrate preferences. The detection system could utilize the coupled luciferase reaction described for E. coli Lgt .

  • Inhibitor screening methodology:

    • Primary screen: Measure IC₅₀ values for inhibition of purified recombinant C. novyi Lgt activity

    • Secondary validation: Test growth inhibition of C. novyi cultures under anaerobic conditions

    • Selectivity assessment: Compare activity against Lgt from different bacterial species

  • Genetic validation: Employ CRISPRi technology to decrease gene expression of lgt in C. novyi, creating a sensitized strain for inhibitor testing, similar to the approach used for E. coli . Decreased expression of lgt should specifically sensitize cells to Lgt inhibitors but not to inhibitors of other targets .

  • Phenotypic confirmation: Evaluate whether inhibitor treatment reproduces the phenotypes observed with Lgt depletion, such as outer membrane permeabilization and morphological changes .

Researchers could use the three Lgt inhibitors identified for E. coli (G9066, G2823, and G2824) as positive controls, which demonstrated IC₅₀ values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively, in biochemical assays .

What are the special challenges in studying Lgt function in obligate anaerobes like C. novyi?

Studying Lgt function in C. novyi presents several methodological challenges that require specialized approaches:

  • Maintaining anaerobic conditions: As an ultra-sensitive obligate anaerobe in its vegetative form, C. novyi cannot survive in virtually any level of oxygen . This necessitates all experiments being conducted in specialized equipment like atmospheric chambers with continuous oxygen monitoring.

  • Life cycle complexity: C. novyi's biphasic life cycle (vegetative and sporulated forms) complicates the study of Lgt expression and function across different growth stages . Researchers must develop protocols to synchronize cultures and distinguish between life stage-specific effects.

  • Genetic manipulation constraints: While CRISPR/Cas9 gene insertion has been demonstrated in C. novyi , genetic tools for anaerobes are less developed than for model organisms. Transformation and selection procedures must be adapted to maintain strict anaerobic conditions.

  • Protein stability concerns: Membrane proteins from strict anaerobes often show increased oxygen sensitivity. Purification and characterization must be performed under stringent oxygen exclusion to maintain native structure and function.

  • Biochemical assay adaptation: Standard enzymatic assays may require modification for compatibility with anaerobic conditions. The coupled luciferase assay described for E. coli Lgt would need validation in an oxygen-free environment.

  • Structural biology barriers: X-ray crystallography or cryo-EM studies would require specialized equipment and techniques to prevent oxygen exposure during sample preparation and analysis.

What is the potential significance of targeting Lgt in C. novyi as compared to other bacterial targets?

Targeting Lgt in C. novyi could have unique significance compared to other bacterial targets:

  • Resistance barrier advantage: The search results indicate that, unlike inhibitors of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to provide resistance to Lgt inhibitors . This suggests that Lgt inhibition may overcome common resistance mechanisms, making it a particularly valuable target.

  • Essentiality across growth states: If C. novyi Lgt resembles E. coli Lgt in its essentiality, targeting this enzyme could affect both vegetative growth and potentially spore formation or germination, providing a multi-phase targeting approach.

  • Cell envelope vulnerability: Lgt inhibition in E. coli leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics . This could be exploited in combination therapy approaches or to enhance immune clearance of C. novyi after tumor treatment.

  • Target validation: The study identified Lgt inhibitors that potently inhibit Lgt biochemical activity in vitro and are bactericidal against wild-type Acinetobacter baumannii and E. coli strains . This cross-species efficacy suggests potential broad-spectrum applications.

  • Novel mechanism: Inhibition of Lgt represents a mechanistically distinct approach from conventional antibiotics, potentially addressing existing resistance issues. The search results validate Lgt as a "novel druggable antibacterial target" .

Research into C. novyi Lgt could also inform broader understanding of lipoprotein biosynthesis in anaerobic bacteria and potentially reveal species-specific adaptations of this conserved pathway.

How might Lgt function influence the tumor-targeting capabilities of C. novyi in cancer therapy applications?

While the search results don't directly connect Lgt function to C. novyi's tumor-targeting capabilities, several hypotheses can be formulated based on known roles of bacterial lipoproteins:

  • Germination regulation: If lipoproteins modified by Lgt are involved in sensing environmental conditions, they may contribute to C. novyi spores' ability to specifically germinate in hypoxic tumor environments but not in healthy tissues . This selective germination is critical to C. novyi's therapeutic utility.

  • Hypoxic adaptation: Proper lipoprotein processing may be essential for C. novyi's adaptation to the unique metabolic conditions found within solid tumors. Lipoproteins could participate in nutrient acquisition or stress responses needed for growth in the tumor microenvironment.

  • Immune system interaction: C. novyi demonstrates "potent recruitment of the immune system due to its gram variability" . As bacterial lipoproteins are known immunostimulatory molecules, Lgt-processed lipoproteins might contribute to this immune recruitment, enhancing anti-tumor responses.

  • Tumor invasion mechanisms: Lipoproteins could contribute to C. novyi's ability to penetrate and spread throughout tumor tissue. The search results mention C. novyi can chemotax toward hypoxic/acidic gradients , and lipoproteins might participate in sensing or response mechanisms.

  • Oncolytic activity: The direct tumor-killing mechanisms of C. novyi might involve lipoproteins processed by Lgt, potentially through interactions with tumor cell membranes or secretion of lytic factors.

Understanding these potential connections could inform genetic engineering approaches to enhance C. novyi's therapeutic efficacy through modifications of Lgt or its lipoprotein substrates.

What experimental approaches would be most effective for comparing Lgt function between C. novyi and Gram-negative bacteria like E. coli?

A comprehensive comparative analysis of Lgt function between C. novyi and E. coli would require multiple experimental approaches:

Table 4: Comparative Analysis Methodologies for Lgt Function

Analysis TypeMethodologyExpected Insights
Sequence analysisBioinformatic comparison of Lgt protein sequencesConservation of catalytic sites and structural features
Substrate preferenceIn vitro biochemical assays with synthetic peptide substratesDifferences in recognition sequences or modification efficiency
Inhibitor sensitivityComparative IC₅₀ determination for known Lgt inhibitorsStructural variations in inhibitor binding sites
Essential natureGrowth phenotypes after gene depletionWhether Lgt is universally essential across species
Lipoprotein repertoireProteomic analysis of lipoproteins in each speciesDifferences in the scope of Lgt's influence
Cross-complementationExpression of C. novyi Lgt in E. coli lgt depletion strainFunctional conservation across species

For biochemical characterization, researchers could adapt the glycerol phosphate release assay described for E. coli Lgt . This assay measures the release of glycerol phosphate as Lgt catalyzes the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate.

To investigate differences in inhibitor sensitivity, researchers could test the potent Lgt inhibitors identified for E. coli (G9066, G2823, and G2824) against recombinant C. novyi Lgt. This would provide insights into structural conservation of the inhibitor binding site.

Genetic approaches similar to the CRISPRi technology used to decrease lgt gene expression in E. coli could be adapted for C. novyi to compare the phenotypic consequences of Lgt depletion across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.