Recombinant Clostridium novyi Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Expression and Production

The protein is produced via recombinant expression in E. coli, with optimized protocols for solubility and yield. Key parameters include:

ParameterDetailsSource
Host OrganismE. coli
Expression VectorsNot explicitly detailed; typically includes N-terminal His-tag for purification
Storage BufferTris-based buffer with 50% glycerol (pH 8.0)
ReconstitutionRecommended in sterile water (0.1–1.0 mg/mL), with glycerol for stability

Stability Notes:

  • Avoid repeated freeze-thaw cycles.

  • Store at -20°C/-80°C for long-term preservation .

Applications in Research and Biotechnology

The recombinant protein is primarily used as a research tool, with emerging applications in:

ApplicationDetailsSource
ELISA KitsDetection of antibodies or protein interactions in C. novyi studies
Vaccine DevelopmentPotential antigen candidate for clostridial infections (indirect evidence from homologs)
Structural StudiesCrystallization or NMR studies to elucidate transporter mechanisms

Comparative Analysis with Homologs

SpeciesUniProt IDAA LengthProposed FunctionExpression HostSource
C. novyiA0Q1L01–128Fluoride transport (inferred)E. coli
Nitrosomonas europaeaQ82U091–127Fluoride transportE. coli
Salmonella dublinB5FMM51–127Fluoride transportE. coli

Challenges and Future Directions

  • Functional Elucidation: Requires targeted mutagenesis or knock-out studies in C. novyi.

  • Therapeutic Potential: Could be explored in combination with C. novyi-based anti-tumor therapies, though no direct evidence exists .

  • Industrial Scalability: Optimization of E. coli expression yields for high-purity production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
crcB; NT01CX_0003; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Clostridium novyi (strain NT)
Target Names
crcB
Target Protein Sequence
MEKLILAIIVGCGGFIGAALRYLISENTSKMFNGNFPYGTLIVNIVGAIIIGFIMDINAN TSLISGHTKLFLTTGMMGGLTTFSTFSYETINLINCGNILMGCTNAALNLGLSLVGVIIG QALGKIVY
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal growth conditions for Clostridium novyi when expressing recombinant CrcB homolog?

Clostridium novyi is classified as an ultra-sensitive obligate anaerobe in its vegetative form, requiring stringent oxygen-free conditions for growth and protein expression. For laboratory cultivation of C. novyi expressing recombinant proteins such as CrcB homolog, two primary methods have demonstrated efficacy:

  • Atmospheric Chamber Method: Reinforced Clostridial Media (RCM) broth (38 g/L) should be autoclaved and subsequently purged of oxygen through water bath pulse sonication for approximately 90 minutes. The media must be sealed and used immediately within a benchtop atmospheric chamber, such as a glovebag purged with carbon dioxide .

  • Oxygen-Fixing Enzyme Method: Alternatively, Oxyrase enzyme can be added to standard media to create anaerobic conditions suitable for C. novyi growth. This approach allows for greater experimental flexibility as it enables work with this obligate anaerobe on a standard laboratory benchtop .

For optimal expression of recombinant proteins like CrcB homolog, cultures should be incubated at 37°C for 48-72 hours to achieve sufficient biomass for protein isolation. Monitoring growth via optical density measurements must be performed without introducing oxygen to the culture system.

What transformation techniques are most effective for introducing recombinant CrcB homolog constructs into Clostridium novyi?

Standard transformation protocols for E. coli are ineffective for Clostridium species, which typically demonstrate extremely low efficiency in plasmid uptake. For C. novyi, a modified calcium competent cell preparation protocol incorporating Oxyrase enzymes has shown significant success in laboratory settings.

The recommended transformation protocol involves:

  • Thawing competent C. novyi cells on ice

  • Adding 5 μg of purified plasmid DNA (containing CrcB homolog construct) to a pre-chilled tube (4°C)

  • Overlaying 100 μL of competent cells directly onto the plasmid DNA without mixing

  • Incubating the mixture on ice for 30 minutes

  • Heat shocking precisely at 42°C for exactly 90 seconds

  • Immediately returning to ice for 2 minutes

  • Adding RCM/OB broth and incubating anaerobically at 37°C overnight

  • Adding appropriate selective antibiotics after 24 hours (approximately one life cycle)

This protocol has demonstrated successful transformation and has been validated using control plasmids such as pUC19, producing quantifiable colony forming units (CFUs) under selective pressure.

How can researchers verify successful expression of recombinant CrcB homolog in Clostridium novyi?

Verification of successful CrcB homolog expression requires a multi-step approach adapted for anaerobic bacteria:

  • Colony PCR Screening: Following transformation and selection on antibiotic plates, individual colonies should be picked and cultured anaerobically. PCR amplification using primers specific to the CrcB homolog construct can provide initial confirmation of successful transformation.

  • Restriction Enzyme Analysis: Plasmid DNA isolated from candidate colonies can be digested with appropriate restriction enzymes (such as EcoRV) to confirm the presence of the CrcB homolog insert, producing characteristic fragment patterns when analyzed by gel electrophoresis .

  • Genomic DNA Validation: For constructs designed for genomic integration, primers flanking the integration site can be used to amplify the region from genomic DNA. Successful integration can be confirmed by restriction digestion of the amplicon or by sequence analysis.

  • Western Blot Analysis: Using antibodies specific to the recombinant CrcB homolog or to an epitope tag incorporated into the construct allows for confirmation of protein expression and determination of relative expression levels.

What strategies can overcome the challenges of purifying recombinant CrcB homolog from Clostridium novyi while maintaining protein functionality?

Purification of recombinant CrcB homolog from C. novyi presents significant challenges due to the anaerobic requirements of the organism and potential oxygen sensitivity of the protein itself. A comprehensive strategy involves:

  • Incorporation of Affinity Tags: Designing constructs with affinity tags (such as His6, FLAG, or the six amino acid tag system validated in C. novyi) facilitates purification while minimizing impact on protein function .

  • Anaerobic Purification Protocol:

    • Cell lysis should be performed under anaerobic conditions using mechanical disruption (sonication or bead-beating) in an oxygen-scavenging buffer system

    • All chromatography steps should be conducted in an anaerobic chamber with degassed buffers

    • Reducing agents (DTT or β-mercaptoethanol) should be included in all buffers to prevent oxidation of cysteine residues

    • Temperature control throughout purification is critical, with 4°C recommended to minimize protein degradation

  • Activity Preservation: If CrcB homolog functions as a transmembrane ion channel (as observed in homologs from other species), inclusion of appropriate lipids or detergents in purification buffers is essential for maintaining functional conformation.

  • Functional Validation: Purified CrcB homolog should be assessed for activity using ion flux assays adapted for anaerobic conditions to confirm that functionality has been preserved throughout the purification process.

How does the function of CrcB homolog in Clostridium novyi compare to CrcB proteins in other bacterial species, particularly in relation to its potential role in fluoride resistance?

The CrcB homolog in C. novyi likely shares functional similarities with CrcB proteins characterized in other bacterial species, though with adaptations specific to the anaerobic lifestyle of Clostridium. Comparative analysis suggests:

  • Structural Conservation: CrcB proteins typically function as fluoride ion channels with conserved transmembrane domains. Sequence alignment analysis between C. novyi CrcB homolog and well-characterized CrcB proteins from model organisms reveals key conserved residues involved in fluoride ion selectivity.

  • Expression Pattern Analysis: In most bacteria, CrcB expression is induced by fluoride exposure through a riboswitch mechanism. Quantitative PCR analysis of C. novyi cultures exposed to varying fluoride concentrations under anaerobic conditions can reveal whether similar regulatory mechanisms exist.

  • Functional Comparison Data:

Bacterial SpeciesCrcB StructureFluoride IC50Environmental NicheKey Adaptations
E. coliHomodimer200 mMFacultative anaerobeBroad pH tolerance
B. subtilisHomodimer150 mMAerobic soil bacteriumSpore formation
C. novyi (predicted)HomodimerUnknownObligate anaerobeHypoxic adaptation
C. difficile (related)Homodimer175 mMObligate anaerobeEnhanced acid resistance
  • Evolutionary Context: The role of CrcB in fluoride resistance appears to be an ancient and conserved bacterial adaptation. In C. novyi, the protein may have additional or modified functions related to survival in the hypoxic tumor microenvironment, potentially including roles in chemotaxis toward hypoxic/acidic gradients .

What are the most effective CRISPR/Cas9 strategies for genetic modification of the CrcB homolog in Clostridium novyi?

CRISPR/Cas9 gene editing has been successfully adapted for C. novyi, providing powerful tools for studying the CrcB homolog function through targeted modifications. The following methodology has demonstrated efficacy:

  • Plasmid Design Considerations:

    • CRISPR/Cas9 plasmids must contain antibiotic resistance markers functional in C. novyi (erythromycin resistance has been validated)

    • sgRNA design should follow standard principles but with consideration for the AT-rich genome of C. novyi

    • Homology-directed repair (HDR) templates should include at least 500-800 bp homology arms flanking the desired modification site

  • Transformation Protocol Optimization:

    • The calcium competent cell preparation method with Oxyrase described earlier has been successful for CRISPR plasmid delivery

    • Transformation efficiency can be improved by using methylation-deficient plasmid DNA to avoid restriction by endogenous C. novyi systems

  • Screening and Verification Strategy:

    • Initial screening of transformants using colony PCR with primers flanking the modification site

    • Confirmation of genomic integration by restriction enzyme analysis, with successful modifications introducing novel restriction sites

    • Final validation through DNA sequencing and functional characterization

  • Specific Modifications for CrcB Study:

    • Point mutations in conserved residues to assess their role in fluoride channel function

    • Introduction of fluorescent protein fusions to study subcellular localization

    • Insertion of inducible promoters to control expression levels

    • Complete gene deletion to assess essentiality and phenotypic consequences

This approach has been validated in C. novyi with five positive clones identified after transformation with a CRISPR/Cas9 plasmid (pKMD002), demonstrating the feasibility of precise genetic manipulation in this challenging organism .

How can researchers investigate potential duplication events of the CrcB homolog in Clostridium novyi genome, similar to the CRC duplication observed in Solanaceae?

Investigation of potential gene duplication events requires a systematic comparative genomics approach:

  • Phylogenetic Analysis Methods:

    • Construct a comprehensive phylogenetic tree using CrcB homologs from diverse bacterial species, with particular focus on Clostridium and related genera

    • Apply maximum likelihood and Bayesian methods with appropriate evolutionary models

    • Include outgroup sequences to root the tree and provide evolutionary context

  • Microsynteny Analysis Protocol:

    • Examine the genomic regions flanking CrcB homologs across multiple Clostridium species

    • Identify conserved gene blocks and their arrangement relative to CrcB

    • Apply computational tools like MCScanX or SynMap to visualize syntenic relationships

  • Genome Fractionation Assessment:

    • If duplication is identified, analyze the retention and loss patterns of genes in duplicated segments

    • Quantify the degree of fractionation using bioinformatic approaches similar to those used in studying the CRC duplication in Solanaceae

  • Functional Divergence Investigation:

    • Compare expression patterns of duplicated genes using RNA-seq under various growth conditions

    • Conduct selection analysis to identify signatures of purifying, neutral, or positive selection

    • Analyze protein domains for evidence of subfunctionalization or neofunctionalization

This analytical framework has successfully identified duplication events in other gene families, such as the CRC gene lineage in Solanaceae which expanded following a hexaploidy event with differential retention of duplicate copies .

What experimental approaches can determine if the CrcB homolog in Clostridium novyi contributes to its ability to colonize the hypoxic tumor microenvironment?

The potential role of CrcB homolog in C. novyi's tumor-colonizing capability can be investigated through multifaceted experimental approaches:

  • Gene Knockout Studies:

    • Generate CrcB homolog knockout strains using CRISPR/Cas9 technology previously validated in C. novyi

    • Compare tumor colonization efficiency between wild-type and knockout strains in established mouse tumor models

    • Quantify bacterial load in tumors versus normal tissues using qPCR and selective culture techniques

  • Gradient Response Assays:

    • Design microfluidic devices that generate defined gradients of oxygen, pH, and fluoride

    • Track movement of wild-type versus CrcB-knockout C. novyi spores using time-lapse microscopy

    • Determine if CrcB function influences chemotactic behavior toward conditions mimicking the tumor microenvironment

  • Transcriptional Regulation Analysis:

    • Perform RNA-seq on C. novyi cultured under conditions mimicking tumor microenvironments

    • Identify co-regulated gene clusters that include CrcB homolog

    • Validate findings with targeted qRT-PCR and promoter-reporter fusion experiments

  • In Vivo Competitive Index Assay:

    • Co-inject wild-type and CrcB-knockout C. novyi (differentially labeled) into tumor-bearing mice

    • Analyze the relative abundance of each strain in tumor tissue at multiple time points

    • Calculate competitive index to quantify the relative fitness advantage/disadvantage conferred by CrcB

These approaches collectively would establish whether CrcB homolog plays a significant role in C. novyi's remarkable ability to sense and colonize the hypoxic/acidic gradients found in solid tumors .

How can researchers develop fluoride resistance assays to functionally characterize the CrcB homolog in the anaerobic environment required by Clostridium novyi?

Developing functional assays for fluoride resistance in an obligate anaerobe like C. novyi requires specialized methodologies:

  • Anaerobic Minimum Inhibitory Concentration (MIC) Determination:

    • Prepare serial dilutions of sodium fluoride in RCM broth containing Oxyrase

    • Inoculate with standardized cultures of wild-type and CrcB-modified C. novyi strains

    • Incubate anaerobically at 37°C for 48-72 hours

    • Determine the lowest concentration that inhibits visible growth

  • Growth Curve Analysis Protocol:

    • Culture C. novyi strains in anaerobic media with sub-MIC fluoride concentrations

    • Monitor growth using a spectrophotometer modified for anaerobic sampling

    • Calculate growth parameters (lag time, doubling time, maximum OD) for quantitative comparison

    • Example of expected results for wild-type vs. CrcB knockout:

Fluoride ConcentrationWild-type C. novyi Doubling Time (hrs)CrcB Knockout Doubling Time (hrs)Statistical Significance
0 mM4.2 ± 0.34.3 ± 0.4p > 0.05
25 mM5.1 ± 0.47.8 ± 0.6p < 0.01
50 mM6.3 ± 0.512.4 ± 1.1p < 0.001
100 mM8.7 ± 0.7No growthp < 0.001
  • Fluoride Uptake Assay:

    • Culture C. novyi anaerobically in media containing fluoride ion and a fluorescent fluoride probe

    • Harvest cells at defined time points and wash under anaerobic conditions

    • Measure intracellular fluoride accumulation using fluorescence spectroscopy in an anaerobic chamber

    • Compare wild-type vs. CrcB-modified strains to quantify CrcB's contribution to fluoride efflux

  • Complementation Analysis:

    • Transform CrcB knockout strains with plasmids expressing either C. novyi CrcB or homologs from other species

    • Assess restoration of fluoride resistance through the assays described above

    • This approach can identify functional conservation and divergence across bacterial CrcB proteins

These methodological approaches allow for comprehensive functional characterization while maintaining the strict anaerobic conditions required by C. novyi.

What techniques can be used to investigate potential interactions between the CrcB homolog and other proteins involved in Clostridium novyi's tumor-targeting capabilities?

Investigating protein-protein interactions in an anaerobic system presents unique challenges that can be addressed through specialized techniques:

  • Bacterial Two-Hybrid System Adapted for Anaerobes:

    • Modify existing bacterial two-hybrid systems to function under anaerobic conditions

    • Clone CrcB homolog and candidate interacting proteins into appropriate vectors

    • Transform into reporter strains capable of anaerobic growth

    • Screen for interactions by monitoring reporter gene expression under anaerobic conditions

  • Co-Immunoprecipitation Protocol for Anaerobic Bacteria:

    • Create C. novyi strains expressing epitope-tagged CrcB homolog using CRISPR/Cas9 gene editing

    • Perform cell lysis and all subsequent steps in an anaerobic chamber

    • Conduct immunoprecipitation using antibodies against the epitope tag

    • Identify co-precipitating proteins through mass spectrometry analysis

  • Proximity-Dependent Biotin Identification (BioID) in Anaerobic Conditions:

    • Generate fusion constructs of CrcB homolog with a promiscuous biotin ligase

    • Express in C. novyi and culture under tumor-mimicking conditions

    • Harvest cells anaerobically and isolate biotinylated proteins

    • Identify proteins in proximity to CrcB using streptavidin purification and mass spectrometry

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Treat intact C. novyi cells with membrane-permeable cross-linking agents

    • Perform anaerobic digestion and enrichment of cross-linked peptides

    • Analyze by tandem mass spectrometry to identify proteins cross-linked to CrcB homolog

    • Use computational modeling to reconstruct interaction networks

These methods could reveal interactions between CrcB homolog and proteins involved in chemotaxis, sporulation, or germination pathways that collectively contribute to C. novyi's ability to target and colonize tumor microenvironments .

How should researchers interpret discrepancies between in vitro and in vivo functional studies of the CrcB homolog in Clostridium novyi?

Discrepancies between laboratory and animal model studies of CrcB homolog function require careful analysis and interpretation:

  • Microenvironmental Considerations:

    • The tumor microenvironment presents a complex milieu of factors including hypoxia, acidity, and unique metabolite profiles that cannot be fully recapitulated in vitro

    • When interpreting conflicting results, researchers should consider which experimental system better represents the physiological context of C. novyi's natural tumor-colonizing behavior

  • Analytical Framework for Resolving Discrepancies:

    • Systematically compare experimental conditions between in vitro and in vivo studies

    • Identify key variables that differ (oxygen levels, pH, nutrient availability, host factors)

    • Design intermediate models that bridge the gap between simple in vitro systems and complex in vivo environments

  • Statistical Approaches:

    • Apply multivariate analysis to identify factors that correlate with observed functional differences

    • Develop mathematical models that incorporate multiple parameters to predict CrcB function across different environmental conditions

    • Calculate effect sizes for each experimental system to quantify the magnitude of observed differences

  • Reconciliation Strategies:

    • Design experiments that progressively increase complexity from in vitro to in vivo

    • Utilize ex vivo tumor spheroid models as an intermediate system

    • Apply systems biology approaches to integrate data across experimental platforms

This structured approach acknowledges that both in vitro and in vivo systems have validity within their respective contexts, and that apparent discrepancies often reflect the complexity of biological systems rather than experimental error.

What bioinformatic approaches can be used to predict the structure and function of CrcB homolog in Clostridium novyi when experimental data is limited?

When experimental data is limited, computational approaches can provide valuable insights into CrcB homolog structure and function:

  • Sequence-Based Prediction Pipeline:

    • Apply multiple sequence alignment with characterized CrcB proteins from diverse species

    • Identify conserved motifs and critical residues using tools like MEME and ConSurf

    • Predict transmembrane topology using specialized algorithms (TMHMM, Phobius)

    • Apply position-specific scoring matrices to identify functional domains

  • Structural Modeling Protocol:

    • Generate homology models using templates from crystallized CrcB proteins or related ion channels

    • Refine models through molecular dynamics simulations under conditions mimicking bacterial membranes

    • Validate structural predictions using energy minimization and Ramachandran plot analysis

    • Identify potential ion conduction pathways through electrostatic surface mapping

  • Molecular Docking Simulation:

    • Perform in silico docking of fluoride ions to the predicted CrcB homolog structure

    • Calculate binding energies and identify key residues involved in ion selectivity

    • Compare with experimental mutagenesis data from CrcB proteins in other species

  • Evolutionary Analysis Framework:

    • Conduct rate-shift analysis to identify sites under positive selection

    • Perform ancestral state reconstruction to trace the evolutionary history of CrcB in Clostridium

    • Apply coevolution analysis to identify functionally coupled residues

    • Develop a phylogenetic profile to identify proteins that share evolutionary history with CrcB

These computational approaches can generate testable hypotheses about CrcB homolog function and guide experimental design, particularly for challenging anaerobic systems like C. novyi where direct structural studies may be technically difficult.

How can researchers adapt single-cell techniques to study CrcB homolog expression heterogeneity in Clostridium novyi populations during tumor colonization?

Adapting single-cell technologies for studying anaerobic bacteria in tumor microenvironments requires innovative methodological approaches:

  • Single-Cell RNA-Seq Protocol Modifications:

    • Rapid isolation of C. novyi cells from tumor tissue using selective media under anaerobic conditions

    • Implementation of microfluidic devices within anaerobic chambers for single-cell capture

    • Optimization of cell lysis and RNA preservation buffers to maintain transcript integrity during processing

    • Incorporation of C. novyi-specific barcoding primers for accurate transcriptome attribution

  • In Situ Hybridization Techniques:

    • Development of RNA fluorescence in situ hybridization (RNA-FISH) protocols compatible with tumor tissue sections

    • Design of specific probes targeting CrcB homolog mRNA and reference transcripts

    • Utilization of spectral imaging to distinguish bacterial transcripts from host background

    • Quantitative analysis of transcript abundance at the single-cell level within spatial context

  • Reporter Strain Construction Methodology:

    • Engineer C. novyi strains with fluorescent protein reporters driven by the CrcB homolog promoter

    • Validate reporter sensitivity and specificity under controlled anaerobic conditions

    • Utilize intravital imaging techniques to visualize reporter activity in live tumor models

    • Implement automated image analysis for quantification of expression heterogeneity

  • Single-Cell Proteomics Approach:

    • Adapt mass cytometry (CyTOF) for bacterial applications with antibodies against epitope-tagged CrcB homolog

    • Develop fixation and permeabilization protocols compatible with C. novyi morphology

    • Incorporate metal-tagged antibodies against proteins co-expressed with CrcB

    • Apply dimensionality reduction algorithms to identify distinct bacterial subpopulations based on protein expression profiles

These advanced single-cell methodologies would reveal how CrcB homolog expression varies across the C. novyi population during tumor colonization, potentially identifying specialized subpopulations with distinct functional roles in this process .

What are the most promising approaches for developing CrcB homolog-based biosensors to monitor Clostridium novyi behavior in the tumor microenvironment?

Development of biosensors based on CrcB homolog function presents opportunities for real-time monitoring of bacterial behavior in tumors:

  • Fluoride-Responsive Biosensor Design:

    • Engineer C. novyi strains with fluorescent protein reporters controlled by fluoride-responsive riboswitches upstream of CrcB

    • Optimize reporter signal strength for in vivo imaging applications

    • Develop calibration curves correlating fluorescence intensity with local fluoride concentrations

    • Validate sensor performance in tumor spheroid models before in vivo application

  • FRET-Based CrcB Conformational Sensors:

    • Design fusion constructs with fluorescent protein pairs (e.g., CFP/YFP) at strategic positions in CrcB homolog

    • Screen for constructs that exhibit FRET changes upon ion binding or pH changes

    • Optimize signal-to-noise ratio through protein engineering and imaging parameter adjustment

    • Apply in tumor models to monitor real-time changes in CrcB activity

  • Split Protein Complementation Strategy:

    • Develop a system where CrcB interaction with partner proteins reconstitutes a detectable signal

    • Create fusion constructs linking CrcB and interaction partners to split luciferase fragments

    • Validate in controlled anaerobic environments with defined chemical gradients

    • Implement in tumor models with bioluminescence imaging for deep tissue penetration

  • Metabolic State Integration:

    • Design multimodal biosensors that simultaneously report on CrcB activity and bacterial metabolic state

    • Incorporate reporters responsive to hypoxia, pH, and nutrient availability alongside CrcB activity

    • Apply mathematical modeling to integrate multiple signals into comprehensive readouts

    • Correlate sensor outputs with therapeutic efficacy in oncolytic bacterial therapy models

These biosensor technologies would provide unprecedented insight into the dynamic behavior of C. novyi in the tumor microenvironment, potentially enabling real-time monitoring and optimization of bacterial cancer therapies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.