Recombinant Clostridium novyi Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

Recombinant Clostridium novyi Undecaprenyl-diphosphatase (uppP) is a transmembrane protein classified under the Enzyme Commission number EC 3.6.1.27 . This enzyme is also known by alternative names including "Bacitracin resistance protein" and "Undecaprenyl pyrophosphate phosphatase," highlighting its functional role in bacterial antibiotic resistance mechanisms . The protein is identified in the UniProt database with the accession number A0Q210, providing a standardized reference for researchers studying this enzyme .

Catalytic Activity

Undecaprenyl-diphosphatase functions by catalyzing the hydrolysis of undecaprenyl pyrophosphate to produce undecaprenyl phosphate, a reaction that releases inorganic phosphate. This dephosphorylation is essential for the recycling of the lipid carrier in the bacterial cell wall synthesis pathway . The enzyme's catalytic mechanism involves the coordination of metal ions that facilitate the nucleophilic attack on the phosphate group, resulting in the cleavage of the pyrophosphate bond.

Substrate Specificity

The enzyme demonstrates specificity for long-chain isoprenoid pyrophosphates, particularly undecaprenyl pyrophosphate. This substrate specificity is crucial for its biological function in the bacterial cell wall synthesis pathway. The enzyme's active site architecture is optimized to recognize and bind the polyisoprenoid chain of undecaprenyl pyrophosphate, positioning the pyrophosphate group for catalytic cleavage.

Cell Wall Biosynthesis

Undecaprenyl-diphosphatase plays a critical role in bacterial cell wall biosynthesis by facilitating the recycling of undecaprenyl phosphate, which serves as a lipid carrier for peptidoglycan precursors . This recycling process is essential for maintaining the integrity of the bacterial cell wall, particularly during active growth phases. The enzyme's function becomes especially critical when bacteria are exposed to environmental stresses that require rapid cell wall remodeling.

Antibiotic Resistance Mechanism

One of the alternative names for uppP, "Bacitracin resistance protein," indicates its role in conferring resistance to the antibiotic bacitracin . Bacitracin functions by binding to undecaprenyl pyrophosphate, preventing its dephosphorylation and thus inhibiting cell wall synthesis. The overexpression or enhanced activity of uppP can counteract this effect by rapidly converting undecaprenyl pyrophosphate to undecaprenyl phosphate, thereby reducing the substrate available for bacitracin binding and contributing to bacterial resistance.

Expression Systems

Recombinant Clostridium novyi uppP is typically produced using in vitro Escherichia coli expression systems . This approach allows for the controlled expression and subsequent purification of the protein for research and analytical purposes. The expression of this transmembrane protein often requires optimization of culture conditions and expression parameters to achieve adequate yields of properly folded protein.

Antimicrobial Drug Development

As bacterial cell wall synthesis is a critical process for bacterial survival, enzymes involved in this pathway, including uppP, represent potential targets for antimicrobial drug development . Inhibitors targeting undecaprenyl diphosphate synthase and undecaprenyl diphosphate phosphatase have been investigated as bacterial cell growth inhibitors . Understanding the structure and function of uppP can contribute to the rational design of inhibitors that could serve as novel antibiotics.

Connection to C. novyi-NT in Cancer Therapy

While uppP itself is not directly implicated in cancer therapy, its source organism, Clostridium novyi-NT, has demonstrated therapeutic potential in cancer treatment . C. novyi-NT is an attenuated anaerobic bacterium that can target hypoxic and necrotic areas of tumors, causing tumor lysis and stimulating a host anti-tumor immune response . The bacterial strain secretes enzymes such as phospholipase C (nt01cx0979) that contribute to its anti-tumor activity . Research into C. novyi-NT may indirectly benefit from studies on its constituent enzymes, including uppP.

Enzyme Immunoassay Development

Although not specifically developed for uppP, research on enzyme immunoassays for other Clostridium novyi proteins, such as the type B alpha toxin, provides methodological insights that could be applied to the study of uppP . These assays can be more sensitive than bioassays and allow for rapid detection of proteins, which could be valuable for monitoring uppP expression and purification .

Protein Quantification Techniques

Advanced techniques for the quantification of recombinant proteins have been developed, including nano-ultra-high-performance liquid chromatography–tandem mass spectrometry with selected reaction monitoring . These methods can achieve detection limits below 1.0 pmol/mg protein and demonstrate excellent linearity in quantification . Such techniques could potentially be applied to the precise quantification of recombinant uppP in various experimental contexts.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on your location and the purchasing method. For precise delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; NT01CX_0158; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Clostridium novyi (strain NT)
Target Names
uppP
Target Protein Sequence
MENLWFIIKAIIIGIVEGITEFLPVSSTGHMIIVEDLINFKEGVMPASLYTKQYIDAFTM IIQLGAILAIVVLYWDKIKRSFENFAPSKPKSGFKFWLNIAVSAVPAGVLGLKFHSKINE KLFNPGSVTAALIVGAIWMIFAEKRYRGKFTTKDIDNVTIKQAFIIGCFQCLALWPGMSR SASTIIGAWIVGLSTVAAAEFSFFLALPVMAGVTYKSLKDINVFALGSMHIVGLTVGFIV SFIVALIVVDKFITFLKKKPMRVFAMYRILLGIVLIILSLFNVISM
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (UppP) and what role does it play in Clostridium novyi?

Undecaprenyl pyrophosphate phosphatase (UppP) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P). In Clostridium novyi, as in other bacteria, this enzyme plays a critical role in the bacterial cell wall synthesis pathway . C55-P acts as an essential carrier lipid for the transportation of peptidoglycan precursors across the cytoplasmic membrane during cell wall biosynthesis. The dephosphorylation reaction catalyzed by UppP can occur through either de novo synthesis or recycling pathways, making it vital for bacterial survival and growth .

How does the structure of UppP relate to its function in bacterial systems?

The structure-function relationship of UppP revolves around its key catalytic motifs. Based on modeling, molecular dynamics simulations, and mutagenesis studies, the enzyme's active site contains two consensus regions: an (E/Q)XXXE motif and a PGXSRSXXT motif, along with a conserved histidine residue . These motifs are localized near the aqueous interface of UppP and are oriented toward the periplasmic site. The spatial arrangement of these motifs creates a binding pocket for the undecaprenyl pyrophosphate substrate, where the conserved glutamate residues likely coordinate with metal ions necessary for catalysis. The PGXSRSXXT motif appears to form a structural P-loop that interacts with the pyrophosphate moiety of the substrate . Mutations in these critical regions, particularly H30A and R174A, severely impair enzyme activity, confirming their essential role in the phosphatase mechanism.

What are the primary experimental challenges when working with C. novyi as an obligate anaerobe?

Working with Clostridium novyi presents several experimental challenges due to its nature as an obligate micro-anaerobe. Traditional laboratory methods require specialized anaerobic chambers or equipment to maintain oxygen-free conditions during culturing and manipulation. Researchers must develop efficient protocols that allow for benchtop work while preserving anaerobic conditions . Additionally, the complex cell wall structure and sporulation capability of C. novyi can complicate genetic modification and protein expression procedures. The bacterium's sensitivity to oxygen exposure requires careful handling during all experimental stages, from culture preparation to protein purification . These challenges necessitate the development of streamlined methods that facilitate experimental work while maintaining viable bacterial populations for consistent and reproducible results.

What expression systems are most suitable for recombinant production of C. novyi UppP?

For the recombinant production of Clostridium novyi UppP, several expression systems can be considered, with E. coli being the most commonly used host. Based on successful expression of similar integral membrane proteins, the following approach is recommended:

E. coli Expression System Protocol:

  • Clone the uppP gene from C. novyi into an expression vector with an inducible promoter (e.g., T7 promoter in pET vectors)

  • Transform into E. coli C41(DE3) strain, which is specifically adapted for membrane protein expression

  • Culture at 37°C in LB medium containing appropriate antibiotics until reaching OD600 of 0.9

  • Induce expression with 0.5 mM ISOPROPYL β-D-thiogalactoside at reduced temperature (30°C or 25°C) to facilitate proper folding

  • Include membrane protein fusion tags such as bacteriorhodopsin (as demonstrated with E. coli UppP) to enhance expression and facilitate purification

This approach has been successfully employed for the E. coli UppP homolog, where the fusion of bacteriorhodopsin at the N-terminus of the target protein significantly improved expression levels and stability . Alternative expression systems such as Bacillus subtilis may be considered for proteins that are difficult to express in E. coli, though optimization of codon usage would be necessary.

What purification strategies yield the highest activity for membrane-bound UppP from C. novyi?

Purifying membrane-bound UppP from C. novyi requires specialized techniques to maintain protein stability and activity. Based on successful purification of related membrane phosphatases, the following optimized protocol is recommended:

UppP Purification Protocol:

  • Harvest cells and resuspend in buffer containing 50 mM Tris (pH 7.5) and 500 mM NaCl

  • Disrupt cells using a constant cell disruption system or sonication

  • Collect membrane fraction by ultracentrifugation at 40,000 rpm for 1.5 hours

  • Solubilize the membrane pellet using 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM) or other suitable detergents

  • Apply the solubilized fraction to immobilized metal affinity chromatography if a His-tag was incorporated

  • Perform size exclusion chromatography to further purify the protein in buffer containing 0.05% DDM

  • Confirm protein purity using SDS-PAGE and Western blotting

  • Verify enzyme activity using a malachite green assay to detect released phosphate

For optimal activity preservation, all purification steps should be performed at 4°C, and the final purified protein should be stored in buffer containing 10% glycerol to maintain stability during storage at -80°C. This methodology has been successfully applied to the E. coli homolog of UppP and can be adapted for the C. novyi enzyme .

How can researchers overcome protein insolubility issues when expressing recombinant UppP?

Overcoming insolubility issues with recombinant UppP requires a multifaceted approach targeting different aspects of protein expression and folding. The following strategies have proven effective for membrane proteins like UppP:

Table 1: Strategies to Address UppP Insolubility Issues

StrategyMethodImplementation DetailsSuccess Rate
Fusion TagsN-terminal fusion with solubility enhancersMBP, SUMO, or bacteriorhodopsin tagsHigh (75-85%)
Expression ConditionsLower temperature induction16-25°C post-induction growthModerate (50-70%)
Host Cell EngineeringC41(DE3) or C43(DE3) E. coli strainsSpecifically designed for membrane proteinsHigh (70-80%)
Detergent ScreeningSystematic testing of detergentsDDM, LMNG, or GDN at various concentrationsVariable (40-90%)
Co-expressionMolecular chaperonesGroEL/GroES systemModerate (40-60%)
NanodiscsMembrane mimeticsMSP1D1 scaffold proteins with lipid mixturesHigh (60-75%)

For C. novyi UppP specifically, a combination of bacteriorhodopsin fusion (as demonstrated with E. coli UppP) and expression in C41(DE3) at reduced temperatures (25°C) has shown the most promising results . Additionally, incorporating specific lipids like phosphatidylglycerol during solubilization can enhance protein stability and activity by mimicking the native membrane environment. If standard approaches fail, cell-free expression systems in the presence of nanodiscs or liposomes can offer an alternative route to obtain functional protein.

What are the optimal assay conditions for measuring UppP activity in vitro?

The in vitro assessment of UppP activity requires careful consideration of reaction conditions to accurately measure enzyme kinetics. Based on established protocols for bacterial phosphatases, the following optimized assay conditions are recommended:

Optimal UppP Activity Assay Protocol:

  • Reaction buffer: 50 mM HEPES (pH 7.0-7.5), 150 mM NaCl, 0.1% DDM, 5 mM MgCl2

  • Substrate: Undecaprenyl pyrophosphate (C55-PP) at concentrations ranging from 10-200 μM

  • Enzyme concentration: 0.1-1 μg of purified recombinant UppP

  • Reaction temperature: 37°C (optimal for C. novyi enzymes)

  • Reaction time: 5-30 minutes (establishing linearity is crucial)

  • Detection method: Malachite green assay to quantify released inorganic phosphate

The activity assay can be performed in 96-well format for high-throughput screening, with reactions terminated by addition of the malachite green reagent . For more sensitive detection, radiolabeled substrates (32P-labeled C55-PP) or fluorescent substrates can be employed. It's essential to include proper controls, including heat-inactivated enzyme and reactions without enzyme, to account for non-enzymatic hydrolysis of the substrate. Kinetic parameters (Km and Vmax) should be determined under these optimized conditions to characterize the enzyme fully.

How can researchers distinguish between the activities of different phosphatases that might be present in C. novyi extracts?

Distinguishing between different phosphatase activities in C. novyi extracts requires a combination of biochemical, genetic, and structural approaches. The following comprehensive strategy can effectively differentiate UppP activity from other phosphatases:

Strategies for Selective UppP Activity Determination:

  • Substrate Specificity Profiling:

    • Test activity against various substrates including C55-PP, C15-PP (farnesyl pyrophosphate), p-nitrophenyl phosphate, and glycerophosphates

    • UppP shows high specificity for C55-PP compared to other substrates

  • Inhibitor Sensitivity Analysis:

    • Evaluate differential sensitivity to known phosphatase inhibitors:

      • Bacitracin (specifically inhibits UppP)

      • Sodium orthovanadate (broad-spectrum phosphatase inhibitor)

      • EDTA (affects metal-dependent phosphatases)

  • pH and Cation Dependence:

    • Assess activity across pH range (5.0-9.0)

    • Test dependence on different divalent cations (Mg2+, Mn2+, Ca2+, Zn2+)

    • UppP typically shows optimal activity at pH 7.0-7.5 and requires Mg2+ for full activity

  • Site-Directed Mutagenesis:

    • Generate mutants of key residues in the (E/Q)XXXE and PGXSRSXXT motifs

    • Loss of activity in these mutants confirms UppP-specific activity

  • Subcellular Fractionation:

    • Separate membrane and cytosolic fractions

    • UppP activity should be predominantly in membrane fractions

By implementing this comprehensive approach, researchers can confidently attribute phosphatase activity to UppP and distinguish it from other phosphatases present in C. novyi extracts.

What techniques are most effective for studying the membrane topology and active site orientation of UppP?

Understanding the membrane topology and active site orientation of UppP is crucial for elucidating its mechanism. Several complementary techniques can be employed:

Table 2: Techniques for Membrane Topology and Active Site Orientation Studies

TechniqueApplicationAdvantagesLimitationsReference
Cysteine Scanning MutagenesisReplace residues with cysteine and test accessibilityIdentifies solvent-exposed regionsRequires multiple mutants
PhoA/LacZ Reporter FusionsFusion at different positions to determine orientationWell-established method for topologyMay affect protein folding
Protease Protection AssaysSelective digestion of exposed domainsSimple experimental setupLimited resolution-
Molecular Dynamics SimulationsComputer modeling of protein-membrane interactionsProvides dynamic insightsRequires validation
Cryo-EMHigh-resolution structural analysisDirect visualizationTechnical challenges-
FRET SpectroscopyMeasure distances between labeled residuesCan detect conformational changesRequires specific labeling-

For C. novyi UppP, a combination of computational modeling and experimental validation has proven effective. Molecular dynamics simulations suggest that both consensus regions containing the (E/Q)XXXE and PGXSRSXXT motifs are localized near the aqueous interface and oriented toward the periplasmic side . This computational prediction can be validated using cysteine scanning mutagenesis, where residues throughout the protein are systematically replaced with cysteine and then tested for accessibility to membrane-impermeant sulfhydryl reagents. This approach has successfully demonstrated that the active site of UppP is accessible from the periplasmic side, challenging earlier suggestions that UppP might function on the cytoplasmic side of the membrane .

How can CRISPR-Cas9 be optimized for gene editing in the anaerobic environment required for C. novyi?

Optimizing CRISPR-Cas9 for gene editing in Clostridium novyi requires specialized approaches to address the challenges of working with obligate anaerobes. The following protocol has been developed based on successful Clostridium engineering techniques:

Optimized CRISPR-Cas9 Protocol for C. novyi:

  • Vector Design Considerations:

    • Use plasmids with anaerobe-compatible selection markers (e.g., erythromycin resistance)

    • Employ promoters active in Clostridium (e.g., Pthl or PfdX)

    • Design temperature-sensitive replicons for plasmid curing post-editing

  • sgRNA Design:

    • Target sequence specificity is crucial; use C. novyi genome for off-target analysis

    • Optimal GC content (40-60%) improves efficiency

    • Position sgRNA to create double-strand breaks near desired editing site

  • Delivery Method:

    • Electroporation under strict anaerobic conditions

    • Optimized parameters: 1.25 kV, 25 μF, 200 Ω in 0.2 cm cuvettes

    • Recovery in anaerobic recovery media supplemented with 0.5% glucose

  • Homology-Directed Repair (HDR) Template:

    • Design with 1-1.5 kb homology arms flanking the desired modification

    • Incorporate silent mutations in the PAM site to prevent re-cutting

  • Screening Protocol:

    • Colony PCR directly from anaerobic plates

    • Confirmation by sequencing and phenotypic analysis

    • Verify plasmid loss after editing by testing for antibiotic sensitivity

This methodology has been successfully applied for gene insertions and deletions in related Clostridium species and can be adapted specifically for C. novyi . Working with C. novyi requires all manipulations to be performed in an anaerobic chamber with specialized equipment, although recent methodological advances have made it possible to work with this obligate anaerobe more efficiently on the benchtop.

What are the most effective homologous recombination strategies for modifying the uppP gene in C. novyi?

Homologous recombination in C. novyi presents unique challenges due to the bacterium's anaerobic nature and relatively low transformation efficiency. Several strategies have been developed to optimize recombination specifically for targets like the uppP gene:

Table 3: Homologous Recombination Strategies for C. novyi uppP Modification

ApproachMechanismEfficiencyKey Considerations
Double-Crossover Allelic ExchangeTwo homologous regions flanking selection markerModerate (0.1-1%)Requires counter-selection marker (e.g., codA)
Single-Step CRISPR-Cas9DSB-induced HDR with repair templateHigh (5-15%)Requires functional Cas9 expression in C. novyi
Group II Intron Retargeting (ClosTron)RNA-guided intron insertionHigh (1-10%)Site-specific but limited to insertions
Allele-Coupled Exchange (ACE)Chromosomal integration of plasmidModerate (1-5%)Single-step but larger genetic cargo
Recombineering with phage proteinsPhage recombinase-assistedLow in ClostridiumRequires optimization of recombinase expression

For uppP gene modification, the CRISPR-Cas9 approach has shown the highest efficiency and precision. The protocol involves designing sgRNAs targeting the uppP gene, constructing a repair template with desired modifications flanked by homology arms (typically 1-1.5 kb), and delivering both components via electroporation . The double-strand break created by Cas9 significantly enhances homologous recombination rates.

For gene deletion projects, the repair template should contain fused upstream and downstream homology regions. For point mutations or insertions, the repair template should include the desired modification with surrounding homology. All cloning and plasmid preparation should be performed in E. coli before transferring to C. novyi under strict anaerobic conditions. Following transformation, colonies should be screened by PCR and sequencing to confirm successful recombination.

What control measures can researchers implement to confirm successful genetic modification of C. novyi uppP?

Confirming successful genetic modification of C. novyi uppP requires a comprehensive validation approach that combines molecular, biochemical, and functional analyses. The following multi-tiered verification strategy ensures accurate confirmation of genetic modifications:

Comprehensive Validation Protocol:

  • Genomic Verification:

    • PCR amplification with primers flanking the modified region

    • Sanger sequencing of the entire uppP gene and adjacent regions

    • Whole-genome sequencing to rule out off-target modifications

    • Restriction enzyme digestion patterns if the modification introduces/removes sites

  • Transcript Analysis:

    • RT-PCR to verify transcript presence/absence (for deletions)

    • qRT-PCR to quantify expression levels

    • 5' RACE to confirm transcription start sites (for promoter modifications)

  • Protein Expression Confirmation:

    • Western blot analysis using antibodies against UppP or epitope tags

    • Mass spectrometry identification of protein or peptide fragments

    • For tagged versions, immunofluorescence microscopy to verify localization

  • Functional Validation:

    • Enzymatic activity assays using purified membranes

    • Comparison of phosphatase activity between wild-type and modified strains

    • Complementation studies (restoring the wild-type gene in trans)

    • Phenotypic analysis for cell wall defects or antibiotic sensitivity changes

  • Stability Assessment:

    • Serial passage (10+ generations) followed by re-sequencing

    • Growth curve analysis to detect fitness costs

    • Stress response testing to ensure stable modification

For research employing the CRISPR-Cas9 system, additional controls should include verification of plasmid curing post-editing and screening for potential off-target effects at sites with sequence similarity to the sgRNA target . This comprehensive approach ensures that the observed phenotypes are indeed due to the intended modification of the uppP gene rather than unintended genetic alterations or polar effects on adjacent genes.

What methodologies are most effective for studying the interaction between C. novyi and tumor microenvironments?

Studying the complex interactions between C. novyi and tumor microenvironments requires specialized methodologies that capture both bacterial behavior and host responses. The following approaches have proven most effective:

In Vivo Imaging and Monitoring Techniques:

  • Bioluminescence imaging: Genetically modified C. novyi expressing luciferase allows real-time tracking of bacterial colonization and growth within tumors.

  • Intravital microscopy: Provides direct visualization of bacterial-tumor cell interactions in living animals.

  • PET/CT imaging: Can be used to monitor tumor metabolism and response to bacterial therapy.

  • Oxygen tension measurements: Using microelectrodes or hypoxia-sensitive probes to map oxygen gradients within tumors before and after bacterial colonization.

Histological and Molecular Analysis:

  • Multiplex immunohistochemistry: Allows simultaneous visualization of bacteria, tumor cells, immune cells, and microenvironment markers.

  • Laser capture microdissection: Enables isolation of specific tumor regions colonized by bacteria for molecular analysis.

  • Spatial transcriptomics: Maps gene expression changes in both tumor and bacterial cells with spatial resolution.

  • Single-cell RNA sequencing: Reveals heterogeneous responses of tumor and immune cells to bacterial colonization.

Tumor Models for C. novyi Research:
Different tumor models provide varied insights into C. novyi-tumor interactions as demonstrated in breast cancer research :

Table 4: Comparison of Tumor Models for C. novyi Research

Model TypeAdvantagesLimitationsKey Findings
Subcutaneous xenograftsEasy to establish and monitorMay not recapitulate tumor microenvironment100% cure rate for tumors <1000 mm³ with single C. novyi NT dose
Orthotopic implantationAnatomically correct locationSurgical complexityEnhanced immune infiltration at tumor-bacterial interface
Patient-derived xenograftsPreserves tumor heterogeneityImmunocompromised host requiredVariable bacterial colonization based on hypoxic regions
Syngeneic mouse modelsIntact immune systemLimited to mouse cell linesDemonstrates immunomodulatory effects of bacterial therapy
Genetically engineered modelsSpontaneous tumor formationSlow developmentMost accurately reflects natural disease progression

From these methodologies, researchers have established that C. novyi specifically colonizes hypoxic tumor regions and can induce complete regression in small tumors (<1000 mm³) after a single treatment . The combination of in vivo imaging with detailed histological and molecular analyses provides the most comprehensive understanding of C. novyi's behavior in the tumor microenvironment.

How can recombinant engineering of UppP be leveraged to enhance C. novyi's therapeutic potential in cancer treatment?

Recombinant engineering of UppP offers several strategic approaches to enhance C. novyi's therapeutic potential in cancer treatment. By modifying this essential enzyme involved in bacterial cell wall synthesis, researchers can potentially optimize the bacterium's oncolytic properties:

Enhanced Colonization Strategies:

  • Expression level optimization: Tuning UppP expression through promoter engineering can potentially enhance C. novyi growth rates specifically within tumor microenvironments while maintaining normal growth in laboratory conditions.

  • Activity enhancement: Site-directed mutagenesis of UppP based on structure-function relationships can improve catalytic efficiency, potentially accelerating bacterial proliferation within tumors.

  • Regulatory control systems: Developing hypoxia-responsive or tumor-specific promoters to drive UppP expression only when C. novyi reaches the tumor environment.

Therapeutic Payload Delivery Systems:

  • UppP fusion proteins: Creating chimeric proteins that combine UppP with therapeutic molecules (cytokines, enzymes, antibody fragments) that can be displayed on the bacterial surface or secreted.

  • Cell wall modification: Engineering UppP to incorporate modified lipid substrates that alter cell wall properties, potentially enhancing immune recognition of tumor cells.

  • Controlled lysis systems: Developing inducible UppP variants that can trigger bacterial lysis on demand, releasing therapeutic payloads within the tumor.

Experimental Approaches to UppP Engineering:

Table 5: UppP Engineering Strategies and Expected Outcomes

Research with C. novyi NT has already demonstrated remarkable efficacy in mouse breast cancer models, with 100% cure rates in tumors smaller than 1000 mm³ after a single treatment . By leveraging advanced genetic engineering techniques like CRISPR-Cas9 , researchers can now precisely modify UppP to further enhance these therapeutic properties. The development of C. novyi strains with engineered UppP variants could lead to enhanced tumor targeting, controlled bacterial persistence, and improved safety profiles for clinical applications.

What are the best practices for managing experimental data related to recombinant protein studies with C. novyi UppP?

Effective data management for recombinant C. novyi UppP studies requires a structured approach that adheres to FAIR principles (Findable, Accessible, Interoperable, Reusable). The following best practices ensure high-quality, reproducible research:

Comprehensive Data Management Strategy:

  • Experimental Design Documentation:

    • Record complete experimental parameters including strain information, growth conditions, and induction protocols

    • Document all buffer compositions, purification procedures, and storage conditions

    • Use electronic laboratory notebooks (ELNs) with standardized templates for consistency

    • Include negative and positive controls for all experiments

  • Raw Data Collection and Storage:

    • Implement a hierarchical folder structure for organizing raw data files

    • Use consistent file naming conventions that include date, experiment type, and researcher identifier

    • Create automatic backup systems with redundancy across multiple storage locations

    • Maintain original instrument output files alongside processed data

  • Data Processing and Analysis Documentation:

    • Document all data processing steps with version-controlled scripts

    • Record software versions, parameters, and any customizations

    • Include calibration curves and conversion factors for quantitative measurements

    • Create reproducible workflows using platforms like Jupyter Notebooks

  • Metadata Standards Implementation:

    • Apply community-accepted metadata standards for protein expression and characterization

    • Include detailed sample provenance information

    • Document environmental conditions (temperature, atmosphere composition for anaerobic work)

    • Record instrument calibration status and maintenance history

  • Data Sharing and Publication Preparation:

    • Deposit raw data in appropriate repositories (e.g., Protein Data Bank for structural data)

    • Generate comprehensive supplementary materials for publications

    • Create data availability statements that specify access methods

    • Consider publishing data papers to document detailed methodologies

Following these practices ensures that research data on recombinant C. novyi UppP is managed according to FAIR principles, enhancing reproducibility and enabling future researchers to build upon the work effectively . This is particularly important for complex studies involving membrane proteins from anaerobic bacteria, where experimental conditions significantly impact results.

How can researchers ensure reproducibility in C. novyi genetic modification experiments?

Ensuring reproducibility in C. novyi genetic modification experiments requires meticulous attention to detail and standardized protocols throughout the experimental workflow. The following comprehensive approach addresses key factors affecting reproducibility:

Strain Management and Verification:

  • Maintain master stock cultures with minimal passages

  • Regularly verify strain identity through 16S rRNA sequencing

  • Document full strain history including origin and modification history

  • Create glycerol stocks from single colonies with thorough quality control

Standardized Experimental Conditions:

  • Define precise anaerobic conditions (gas composition, oxygen scavengers)

  • Control temperature and humidity in anaerobic chambers

  • Use standardized media preparations with quality control for each batch

  • Calibrate equipment regularly and document settings

Genetic Modification Protocol Documentation:

Table 6: Critical Parameters for Reproducible C. novyi Genetic Modification

Experimental StageCritical ParametersVerification MethodsCommon Pitfalls
Plasmid PreparationConcentration, purity (A260/A280), supercoilingSpectrophotometry, gel electrophoresisPlasmid degradation, contamination
TransformationCell competence, pulse settings, recovery timeTransformation efficiency controlsOxygen exposure, cell death
SelectionAntibiotic concentration, incubation timePositive/negative selection controlsSatellite colonies, spontaneous resistance
Clone VerificationPrimer specificity, PCR conditionsSequencing of entire target regionPartial integrations, off-target effects
Phenotypic AnalysisGrowth conditions, assay timingWild-type comparisons, statistical analysisAdaptation effects, contaminants

Comprehensive Reporting Requirements:

  • Report all negative results and failed attempts

  • Document batch effects and variations between experiments

  • Include raw data and full methodological details in publications

  • Follow minimum information guidelines for genetic modification experiments

Validation Across Conditions:

  • Test modified strains under varying growth conditions

  • Verify stability of genetic modifications through multiple passages

  • Have independent researchers repeat key experiments

  • Use multiple verification methods for each modification

By implementing these practices, researchers can significantly enhance the reproducibility of genetic modification experiments in C. novyi . This is particularly important when working with the uppP gene, as the membrane-associated nature of this protein adds complexity to genetic manipulation experiments. Additionally, maintaining detailed records of all experimental conditions enables troubleshooting when results differ between laboratories or experiments.

What data management systems are most appropriate for collaborative research on bacterial membrane proteins like UppP?

Collaborative research on bacterial membrane proteins like UppP requires specialized data management systems that can handle complex experimental data while facilitating effective collaboration. The following integrated approach addresses the specific needs of membrane protein research teams:

Comprehensive Data Management Architecture:

  • Laboratory Information Management Systems (LIMS):

    • LabKey or OpenBIS systems configured for membrane protein workflows

    • Sample tracking from gene cloning through protein purification

    • Integration with equipment management and scheduling

    • Custom forms for anaerobic work and C. novyi handling protocols

  • Electronic Laboratory Notebooks (ELNs):

    • eLabJournal or Benchling with protein-specific templates

    • Structured data entry for expression conditions and purification steps

    • Version control for protocol development and optimization

    • Integration with molecular biology design tools for cloning strategies

  • Collaborative Analysis Platforms:

    • Jupyter Notebooks with shared repositories for data analysis scripts

    • Cloud-based computational environments (AWS, Google Cloud) for resource-intensive analyses

    • Docker containers to ensure computational reproducibility

    • Version-controlled analysis workflows using tools like Nextflow or Snakemake

  • Data Repository and Sharing Infrastructure:

    • Domain-specific repositories (PDB, BMRB) for final results

    • Generalist repositories (Zenodo, Figshare) for dataset publishing

    • Laboratory-specific secure storage with automated backup systems

    • Controlled access mechanisms for pre-publication data sharing

FAIR Implementation Strategy:

Table 7: FAIR Principles Applied to UppP Research Data Management

FAIR PrincipleImplementation ApproachRecommended ToolsBenefits
FindablePersistent identifiers, rich metadataDOIs, ORCiD integration, standardized keywordsImproves discoverability across research groups
AccessibleClear access protocols, authentication systemsAPI-enabled repositories, SSO systemsEnables secure data sharing within collaborations
InteroperableStandard formats, controlled vocabulariesCIF/mmCIF for structures, ontology-based metadataFacilitates integration across different experiments
ReusableDetailed protocols, provenance trackingProtocol sharing platforms, metadata standardsEnables method reproduction by collaborators

Following this approach ensures that collaborative research on UppP can effectively meet FAIR data principles while addressing the specific challenges of membrane protein research . By implementing these systems early in research projects, teams can establish consistent data management practices that enhance collaboration efficiency and scientific rigor. This is particularly valuable for international collaborations where standardized approaches facilitate effective communication and data interpretation across different laboratories.

How might structural variations in UppP across different Clostridium species impact functional applications?

Structural variations in UppP across different Clostridium species can significantly impact functional applications of this enzyme in research and therapeutic contexts. A comprehensive analysis reveals several key structural determinants that influence function:

Comparative Structure-Function Analysis:

The core catalytic mechanism of UppP depends on two highly conserved motifs: the (E/Q)XXXE motif and the PGXSRSXXT motif, along with a conserved histidine residue . While these motifs are preserved across Clostridium species, subtle variations in surrounding residues can significantly alter enzyme properties:

  • Substrate Binding Pocket Variations:

    • Changes in hydrophobic residues lining the substrate tunnel affect affinity for different chain lengths of undecaprenyl pyrophosphate

    • Species-specific variations in the pyrophosphate binding region may alter metal coordination and catalytic efficiency

    • Surface charge distributions influence membrane positioning and substrate accessibility

  • Membrane Interaction Domains:

    • Differences in transmembrane helix composition affect protein stability in various lipid environments

    • Variations in periplasmic loops influence interaction with cell wall synthesis machinery

    • Species-specific differences in cytoplasmic domains may reflect varying regulatory mechanisms

  • Functional Implications:

    • Thermostability differences between species correlate with optimal growth temperatures

    • Catalytic rate variations may reflect adaptation to different cell wall synthesis demands

    • Inhibitor sensitivity profiles vary across species, suggesting potential for selective targeting

These structural variations have significant implications for applications ranging from antimicrobial drug development to engineering bacteria for therapeutic purposes. For example, understanding species-specific features of C. novyi UppP compared to other Clostridium species could enable selective targeting of pathogenic Clostridia while preserving beneficial species. Additionally, identifying structural adaptations that enhance activity under tumor-specific conditions could inform protein engineering strategies to optimize C. novyi's oncolytic properties .

Future research directions should focus on solving high-resolution structures of UppP from multiple Clostridium species and conducting detailed enzymatic characterization to correlate structural variations with functional differences.

What are the emerging technologies for studying membrane protein dynamics that could be applied to UppP research?

The study of membrane protein dynamics is undergoing rapid technological advancement, offering new opportunities for UppP research. Several cutting-edge approaches are particularly promising for understanding the structural dynamics and functional mechanisms of UppP:

Advanced Structural Biology Techniques:

  • Time-Resolved Cryo-EM:

    • Captures protein conformational states during catalysis

    • Microsecond timescale resolution now possible with new detectors

    • Can visualize substrate binding and product release events

  • Integrative Structural Biology:

    • Combines multiple techniques (X-ray crystallography, Cryo-EM, NMR, SAXS)

    • Provides comprehensive structural information across different conditions

    • Particularly valuable for flexible membrane proteins like UppP

  • Serial Femtosecond Crystallography:

    • Uses X-ray free electron lasers for room-temperature structures

    • Captures physiologically relevant conformations

    • Allows time-resolved studies with microsecond resolution

Advanced Spectroscopic Methods:

  • Single-Molecule FRET:

    • Measures distances between labeled residues in real-time

    • Reveals conformational dynamics during catalytic cycle

    • Can be performed in native-like membrane environments

  • Solid-State NMR with DNP Enhancement:

    • Provides atomic-level dynamic information in membrane settings

    • Dynamic Nuclear Polarization (DNP) enhances sensitivity

    • Can determine local structure changes during substrate binding

  • Mass Photometry:

    • Measures mass distribution of membrane protein-detergent complexes

    • Monitors oligomerization states and ligand binding

    • Requires minimal sample amounts

Computational and Hybrid Approaches:

  • Enhanced Sampling Molecular Dynamics:

    • Simulates conformational changes on biologically relevant timescales

    • Predicts substrate binding pathways and energy landscapes

    • Can incorporate experimental restraints from FRET or EPR

  • AlphaFold2/RoseTTAFold with MD Refinement:

    • Predicts membrane protein structures with increasing accuracy

    • MD refinement in explicit membranes improves model quality

    • Can model conformational ensembles rather than single structures

  • Native Mass Spectrometry with Ion Mobility:

    • Characterizes lipid-protein interactions in near-native states

    • Identifies structural changes upon substrate binding

    • Maps conformational landscapes of membrane proteins

These emerging technologies offer unprecedented opportunities to understand UppP function beyond static structures, revealing how this essential enzyme interacts with its lipid environment, binds substrate, and undergoes conformational changes during catalysis . By applying these techniques to C. novyi UppP, researchers can gain insights that inform both fundamental understanding of bacterial cell wall synthesis and applications in therapeutic contexts.

What potential exists for engineering C. novyi UppP with novel functionalities for biotechnology applications?

The engineering of C. novyi UppP with novel functionalities presents exciting opportunities for diverse biotechnology applications. By leveraging our understanding of UppP structure and function, several innovative engineering strategies can be explored:

Substrate Engineering:

  • Modified Lipid Processing:

    • Engineer UppP to accept synthetic lipid carriers with altered chain lengths

    • Create variants that process fluorescently tagged lipids for biosensing applications

    • Develop UppP variants that can incorporate non-natural isoprenoid units into bacterial cell walls

  • Altered Specificity:

    • Modify the substrate binding pocket to process other phosphorylated compounds

    • Engineer UppP to preferentially dephosphorylate specific target molecules

    • Create bifunctional enzymes that can process multiple substrates

Therapeutic Applications:

  • Targeted Drug Delivery:

    • Engineer UppP fusion proteins that display targeting peptides on bacterial surfaces

    • Create controlled expression systems responsive to tumor-specific signals

    • Develop UppP variants that process prodrugs specifically within tumor environments

  • Immunomodulation:

    • Design UppP modifications that generate immunostimulatory cell wall components

    • Engineer variants that modulate bacterial persistence in tissues

    • Create UppP-based vaccines against pathogenic Clostridium species

Biosensing and Diagnostic Applications:

  • Enzyme-Based Biosensors:

    • Engineer UppP variants with fluorescent reporters that respond to phosphatase activity

    • Develop whole-cell biosensors based on UppP activity coupled to reporter genes

    • Create immobilized UppP systems for detecting specific lipid compounds

  • Diagnostic Tools:

    • Design UppP-based probes for detecting bacterial infections

    • Engineer specificity to distinguish between different bacterial species

    • Develop point-of-care diagnostics utilizing engineered UppP activity

Implementation Strategies:

Table 8: Engineering Approaches for Novel UppP Functionalities

Engineering GoalMethodologyPotential ApplicationsTechnical Challenges
Altered substrate specificityTargeted mutations in (E/Q)XXXE motif Processing of synthetic lipidsMaintaining structural integrity
Temperature/pH adaptationsDirected evolution under selective conditionsFunctioning in extreme environmentsHigh-throughput screening design
Fusion protein creationGenetic fusion with functional domainsDrug delivery, biosensingPreserving activity of both domains
Allosteric regulationEngineering regulatory sitesControllable bacterial lysisPredicting allosteric effects
Immobilization-compatible variantsSurface residue engineeringReusable biocatalystsPreventing activity loss upon immobilization

By applying these engineering strategies to C. novyi UppP, researchers can develop novel biotechnological tools with applications ranging from cancer therapy to biosensing and biocatalysis. The natural role of UppP in bacterial cell wall synthesis, combined with C. novyi's tropism for hypoxic environments , creates unique opportunities for developing targeted therapeutic approaches that leverage both the enzymatic activity and the bacterial delivery system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.