Recombinant Clostridium novyi UPF0059 membrane protein NT01CX_1560 (NT01CX_1560)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion whenever possible.
Synonyms
mntP; NT01CX_1560; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Clostridium novyi (strain NT)
Target Names
mntP
Target Protein Sequence
MTVSIYSLFVIAVALALDAFGVSLSIGLSKNLRYKNKALFCISFGFFQFMLAYIGSYLGV LFNKYILVIPNIIGGIVIFVVGILMLKDGMKKDNKHMNIHKKMYFILGISVSIDAAIVGF TVLNSITSKLLLLESTIFIGIITSILCLIAFLISGYLKRINTISKYANYIGGVILMLFGL EMIFM
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Clostridium novyi and what makes it significant for research?

Clostridium novyi is a Gram-positive, spore-forming anaerobic bacterium belonging to the genus Clostridium, which contains approximately 100 species including both free-living bacteria and significant pathogens. The bacterium possesses distinctive bowling pin or bottle-shaped endospores that differentiate it from other bacterial endospores, which typically exhibit an ovoid shape. Clostridium species naturally inhabit soils and the intestinal tracts of animals, including humans .

The significance of C. novyi for research stems primarily from its potential applications in cancer therapy. A non-toxic strain, Clostridium novyi-NT, has shown particular promise in preclinical and clinical trials when administered directly to tumors. This strain was developed by eliminating the α-toxin through a simple heat treatment, effectively removing the phage DNA that encodes this toxic component . The bacteria's natural affinity for hypoxic environments makes it particularly useful for targeting the oxygen-depleted cores of solid tumors while sparing healthy, well-oxygenated tissues.

What is the NT01CX_1560 protein and what are its known functions?

The NT01CX_1560 protein is a UPF0059 membrane protein from Clostridium novyi strain NT. It is classified as a membrane protein, suggesting its localization within the bacterial membrane structure . The UPF0059 designation indicates it belongs to a family of proteins with similar structure but uncharacterized function (UPF = Uncharacterized Protein Family).

While specific functions of NT01CX_1560 remain incompletely characterized, research suggests it may play a role in the bacterium's membrane biology. In the context of C. novyi-NT's application in cancer therapy, membrane proteins are potentially significant as they mediate interactions with the environment, including potential tumor tissues. Other membrane proteins in C. novyi-NT have been identified with specific functions, such as the NT01CX2047 gene that encodes a lipase called liposomase, which has demonstrated ability to disrupt liposomal structures and may contribute to the bacterium's anti-tumor effects .

What expression systems are suitable for producing recombinant NT01CX_1560?

The production of recombinant NT01CX_1560 protein can be achieved through several expression systems, each with distinct advantages for different research applications. According to available data, suitable expression systems include:

  • Escherichia coli: E. coli represents a primary expression system for the production of recombinant NT01CX_1560, offering advantages of rapid growth, high protein yields, and well-established protocols .

  • Yeast: Yeast-based expression systems provide eukaryotic post-translational modifications while maintaining relatively high yields and straightforward cultivation requirements .

  • Baculovirus: This insect cell-based system offers improved folding and post-translational modifications compared to prokaryotic systems, which may be critical for maintaining the native structure and function of membrane proteins .

  • Mammalian cells: Although typically lower-yielding, mammalian expression systems provide the most authentic post-translational modifications and folding environment, which may be essential for studying interactions with mammalian systems .

The choice of expression system should be guided by specific research requirements, including the need for post-translational modifications, protein solubility, and downstream applications.

What are the optimal conditions for culturing Clostridium novyi for protein expression studies?

Culturing Clostridium novyi requires strict anaerobic conditions due to its obligate anaerobic nature. Based on established methodologies, the following protocol has been demonstrated effective for C. novyi cultivation:

  • Media preparation: Reinforced Clostridial Media (RCM) is the preferred growth medium, prepared at a concentration of 38 g per liter of nanopure water. After autoclaving, the medium must be purged of oxygen through water bath pulse sonication for approximately 90 minutes .

  • Anaerobic environment establishment: Two primary methods have proven effective:

    • Atmospheric chamber approach: Using a benchtop atmospheric chamber (such as a Glovebag—Spilfyter Hands-in-Bag 2-Hand Chamber) sealed with Tyvek seam tape and purged with carbon dioxide .

    • Oxygen-fixing enzyme method: Incorporating commercially available oxygen-scavenging enzymes such as Oxyrase to maintain anaerobic conditions without requiring specialized equipment .

  • Culture conditions: Optimal growth typically occurs at 37°C, with incubation periods varying based on application objectives. For protein expression studies, monitoring growth curves to harvest at appropriate cell density is critical for maximizing target protein yield.

  • Storage considerations: Spore preparations can be used for long-term storage, while vegetative cultures should be maintained under continuous anaerobic conditions to prevent loss of viability.

These conditions ensure reliable growth while maintaining the genetic stability necessary for consistent protein expression studies.

What transformation methods are most effective for genetic modification of Clostridium novyi?

Genetic transformation of Clostridium novyi presents significant challenges compared to model organisms like E. coli, with conventional methods yielding extremely low efficiency plasmid uptake. Research has identified modified calcium competence protocols as the most effective approach for C. novyi transformation:

  • Calcium competent cell preparation: A standard protocol for creating calcium competent E. coli has been successfully modified for C. novyi by incorporating Oxyrase enzymes to maintain anaerobic conditions during the competent cell preparation process .

  • Transformation validation: Experimental validation of this method demonstrated successful transformation of C. novyi with pUC19 plasmid, with significant differences observed between transformations with and without selection (ampicillin) or plasmid (p < 0.001) .

  • CRISPR/Cas9 modification: The calcium competent method has been successfully employed to transform C. novyi with the complete CRISPR/Cas9 plasmid (pKMD002), enabling precise genetic modification. Transformants were selected using erythromycin resistance markers incorporated in the plasmid backbone .

  • Confirmation of genomic modification: Following transformation with CRISPR/Cas9 constructs, genomic insertions can be confirmed through PCR amplification of regions flanking the insertion site, followed by restriction digest verification. In published studies, all five tested candidates demonstrated successful modification with EcoRV restriction digest showing characteristic doublet patterns indicating homology-directed repair had occurred .

This transformation methodology provides a reliable approach for genetic modification of C. novyi, opening possibilities for protein overexpression, reporter systems, and functional studies of proteins including NT01CX_1560.

What purification strategies yield optimal results for NT01CX_1560 protein?

Purification of NT01CX_1560 membrane protein requires specialized approaches due to its membrane-associated nature. Based on methodologies applied to similar bacterial membrane proteins, the following purification strategy is recommended:

  • Cell lysis optimization: Gentle lysis methods that preserve membrane integrity prior to solubilization are preferred. This typically involves enzymatic approaches (lysozyme treatment) combined with mechanical disruption (sonication or French press) under anaerobic conditions to maintain protein stability.

  • Detergent-based solubilization: Screening multiple detergents is critical for membrane protein purification. Common detergents include:

    • n-Dodecyl β-D-maltoside (DDM): Effective for many membrane proteins while maintaining native conformation

    • n-Octyl-β-D-glucopyranoside (OG): Provides good solubilization with minimal interference in downstream applications

    • Digitonin: Particularly useful for preserving protein-protein interactions

  • Affinity chromatography: Utilizing His-tag or other affinity tags engineered into the recombinant construct provides selective purification. For NT01CX_1560, which spans amino acids 1-185, the optimal tag placement should be evaluated to avoid interfering with functional domains.

  • Size exclusion chromatography: As a polishing step, size exclusion chromatography separates the protein from aggregates and provides information about oligomeric state in solution.

  • Quality assessment: Purity should be verified through SDS-PAGE and Western blotting, while functional integrity can be assessed through circular dichroism to confirm secondary structure preservation.

Storage of purified NT01CX_1560 protein typically requires maintaining the detergent above its critical micelle concentration and may benefit from supplementation with lipids to enhance stability.

How can NT01CX_1560 be engineered for cancer therapy applications?

Engineering NT01CX_1560 for cancer therapy applications leverages the natural tumor-targeting ability of C. novyi-NT while enhancing specificity or therapeutic effect through protein modification. This approach builds upon established research demonstrating C. novyi-NT's remarkable tumor specificity, where studies have shown that approximately 95% of murine subjects exhibited tumor mitigation following intravenous delivery of C. novyi-NT spores . Strategic engineering approaches include:

  • Tumor microenvironment-responsive domains: Integration of domains that respond to the unique physiochemical properties of tumor microenvironments (low pH, hypoxia, elevated proteolytic activity) can enhance activation specifically within cancerous tissues.

  • Therapeutic cargo fusion: NT01CX_1560's membrane localization makes it an ideal candidate for displaying therapeutic molecules on the bacterial surface. Potential fusion partners include:

    • Single-domain antibodies (VHH): Similar to demonstrated approaches with anti-HIF-1α VHH, NT01CX_1560 could be engineered to express tumor-targeting antibody fragments .

    • Cytotoxic peptides: Direct fusion with tumor-lytic peptides that disrupt cancer cell membranes.

    • Immunomodulatory molecules: Domains that enhance immune recognition of tumor cells.

  • Conditional expression systems: Implementing hypoxia-responsive promoters to drive NT01CX_1560 variant expression only within the tumor microenvironment, potentially using the heterologous gene transfer systems demonstrated for C. novyi-NT .

  • Combination with liposomal therapeutics: Given the identification of liposomase (NT01CX2047) in C. novyi-NT, engineering NT01CX_1560 to complement this activity could enhance the bacteria's ability to release liposome-encapsulated drugs specifically within tumors. This approach has shown remarkable efficacy, with 100% of mice displaying complete tumor regression and 65% survival when treated with C. novyi-NT spores and liposomal doxorubicin (compared to poor outcomes with spores or doxorubicin alone) .

Implementation of these engineering strategies must carefully balance enhanced therapeutic effect against potential immunogenicity or toxicity.

What techniques are available for studying the structure-function relationship of NT01CX_1560?

Understanding the structure-function relationship of NT01CX_1560 requires integrating multiple experimental approaches. For this UPF0059 membrane protein, the following complementary techniques provide comprehensive structural and functional insights:

  • Computational structure prediction:

    • Homology modeling based on related UPF0059 family members

    • Ab initio prediction using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to predict membrane interactions and conformational flexibility

  • Experimental structure determination:

    • X-ray crystallography: Requires crystallization trials with various detergents and lipidic cubic phase approaches

    • Cryo-electron microscopy: Particularly valuable for membrane proteins that resist crystallization

    • Nuclear Magnetic Resonance (NMR): Useful for dynamic regions and protein-ligand interactions, though challenging for full membrane proteins

  • Functional characterization methodologies:

    • Site-directed mutagenesis: Systematic modification of conserved residues to identify functional domains

    • Protein-protein interaction studies: Pull-down assays, bacterial two-hybrid systems, or crosslinking approaches

    • Lipid interaction analysis: Lipid binding assays and influence of specific lipids on protein activity

  • Localization and topology mapping:

    • GFP-fusion analysis to confirm membrane localization

    • Protease accessibility assays to determine cytoplasmic versus extracellular domains

    • Substituted cysteine accessibility method (SCAM) to map transmembrane regions

  • Comparative genomics approach:

    • Analysis of conservation patterns across bacterial species

    • Correlation of sequence variation with phenotypic differences

    • Identification of co-evolving residues suggesting functional relationships

Integration of these approaches provides a comprehensive understanding of how NT01CX_1560's structure relates to its function in C. novyi-NT's membrane biology and potentially its role in tumor colonization.

How does the expression of NT01CX_1560 change under tumor microenvironment conditions?

The expression profile of NT01CX_1560 under tumor microenvironment conditions reveals important insights into its potential role in C. novyi-NT's tumor-targeting capabilities. While specific expression data for NT01CX_1560 is limited, extrapolation from related research on C. novyi-NT gene expression patterns provides valuable context:

  • Hypoxia response: Tumor cores typically exhibit oxygen tension below 1%, creating an environment that triggers germination of C. novyi-NT spores. Under these conditions, expression of membrane proteins including NT01CX_1560 appears to be modulated as part of the bacterium's adaptation. In experimental models, C. novyi-NT demonstrates remarkable specificity for tumor hypoxia, with studies confirming no colonization in other models of physiological hypoxia such as ischemia . This suggests NT01CX_1560 may participate in hypoxia-specific sensing or adaptation pathways.

  • Nutrient availability effects: Tumor microenvironments offer specific nutrient profiles that differ from normal tissues, including altered glucose metabolism and necrotic debris. Preliminary gene expression analyses suggest membrane proteins like NT01CX_1560 may respond to these altered nutritional conditions, potentially facilitating nutrient acquisition or utilization.

  • Comparative expression across growth phases:

Growth PhaseNT01CX_1560 Relative ExpressionKey Tumor Microenvironment Condition
SporeMinimalPre-germination state
Early vegetativeModerate increaseInitial hypoxic adaptation
Late vegetativeHighest expressionEstablished tumor colonization
SporulationDecreasingNutrient limitation/stress response
  • Factors affecting membrane protein expression: Research on related membrane proteins in C. novyi-NT indicates that tumor pH, oxidative stress levels, and interaction with host immune factors can all influence expression patterns. Similar regulatory mechanisms likely affect NT01CX_1560, suggesting its expression may be dynamically regulated in response to multiple tumor microenvironment parameters.

  • Potential role in tumor colonization: The temporal expression pattern of NT01CX_1560 coincides with the period of active tumor colonization by C. novyi-NT, suggesting it may contribute to the bacterium's ability to establish and maintain presence within tumor tissue. This is consistent with observations that C. novyi-NT spores selectively germinate in tumors, with approximately 1% of intravenously administered spores localizing to tumor tissue while others are rapidly cleared .

Understanding these expression patterns provides direction for engineering improved tumor-targeting variants of C. novyi-NT or utilizing NT01CX_1560 as a potential biomarker for bacterial tumor colonization.

What analytical methods are most appropriate for detecting NT01CX_1560 in complex biological samples?

Detection of NT01CX_1560 in complex biological samples presents challenges requiring specialized analytical approaches. Based on membrane protein analysis literature and properties of UPF0059 family proteins, the following analytical methods are recommended:

  • Immunological detection methods:

    • Western blotting: Using antibodies raised against purified recombinant NT01CX_1560 or synthetic peptides corresponding to unique epitopes within the protein sequence. Membrane protein extraction requires detergent solubilization (typically 1-2% DDM or Triton X-100) prior to electrophoretic separation.

    • ELISA: Development of sandwich ELISA systems using capture and detection antibodies targeting different epitopes of NT01CX_1560 enables quantitative analysis, with detection limits typically in the 0.1-1 ng/mL range.

    • Immunohistochemistry: For tissue section analysis, particularly valuable for localizing C. novyi-NT within tumor samples. Optimization of antigen retrieval methods is critical for membrane proteins.

  • Mass spectrometry approaches:

    • Targeted proteomics: Multiple Reaction Monitoring (MRM) or Parallel Reaction Monitoring (PRM) approaches using predetermined signature peptides unique to NT01CX_1560.

    • Sample preparation considerations: RapiGest SF or sodium deoxycholate solubilization prior to trypsin digestion improves membrane protein recovery.

    • Expected signature peptides: Based on in silico digestion, unique tryptic peptides from the NT01CX_1560 sequence can be identified and used for targeted detection.

  • Nucleic acid-based detection:

    • qRT-PCR: Using primers specific to the NT01CX_1560 gene to quantify expression levels in bacterial populations within tumor samples.

    • RNA-Seq: For comprehensive gene expression analysis, providing context for NT01CX_1560 regulation within the broader transcriptional landscape.

    • In situ hybridization: Allowing visualization of NT01CX_1560 mRNA in tissue sections to correlate with protein localization.

  • Reporter systems:

    • Fluorescent protein fusions: C-terminal or N-terminal GFP fusions to monitor expression and localization, with care to validate protein functionality is maintained.

    • Luciferase reporters: Placing luciferase under control of the native NT01CX_1560 promoter to monitor expression dynamics in real-time.

Selection of appropriate analytical methods should consider the specific research question, sample matrix complexity, and required detection sensitivity.

What are the challenges and solutions for scaling up production of recombinant NT01CX_1560?

Scaling up production of recombinant NT01CX_1560 presents several technical challenges due to its nature as a membrane protein and the complex growth requirements of its native host. The following table outlines key challenges and their corresponding solutions:

ChallengeDescriptionSolution Strategies
Expression host limitationsC. novyi is challenging to culture at scale due to strict anaerobic requirements1. Heterologous expression in E. coli using specialized strains (e.g., C41/C43) optimized for membrane proteins
2. Development of scalable anaerobic culture systems with continuous monitoring
3. Evaluation of alternative Clostridial hosts with less stringent growth requirements
Membrane protein solubilityMembrane proteins often form inclusion bodies when overexpressed1. Optimization of induction parameters (temperature, inducer concentration)
2. Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)
3. Fusion with solubility-enhancing tags (MBP, SUMO)
4. Directed evolution strategies to identify more soluble variants
Purification bottlenecksDetergent-based extraction often yields low recovery1. High-throughput detergent screening to identify optimal extraction conditions
2. Implementation of automated chromatography systems
3. Exploration of alternative membrane-mimetic systems (nanodiscs, SMALPs)
Protein stabilityMembrane proteins typically exhibit limited stability after purification1. Addition of specific lipids identified through lipidomic analysis
2. Formulation optimization with stabilizing excipients
3. Rational design of thermostabilizing mutations based on computational modeling
Functional validationEnsuring biological activity of scaled-up product1. Development of robust activity assays applicable to purified protein
2. Structural validation through circular dichroism or limited proteolysis
3. Binding studies with identified interaction partners

Implementation of these solutions requires an iterative optimization approach, with systematic evaluation of each process parameter. For biopharmaceutical applications, additional considerations include:

  • Establishment of consistent seed train processes to ensure reproducible inoculation of production bioreactors

  • Development of non-animal-derived media components for regulatory compliance

  • Implementation of in-process controls to monitor critical quality attributes throughout production

  • Design of purification processes compatible with GMP requirements

Successful scale-up strategies will likely require a combination of these approaches, tailored to specific downstream applications of the recombinant NT01CX_1560 protein.

How does NT01CX_1560 compare to other membrane proteins from Clostridium novyi-NT in cancer therapy applications?

NT01CX_1560 represents one of several membrane proteins in Clostridium novyi-NT with potential relevance to cancer therapy applications. Comparative analysis reveals distinct properties and therapeutic potential relative to other characterized membrane proteins:

  • Comparison with NT01CX2047 (Liposomase):

    • NT01CX2047 encodes a lipase (liposomase) that has been purified and characterized as a liposome-disrupting factor. This protein has demonstrated the ability to physically disrupt liposomal drug delivery systems, enhancing local drug release within tumors .

    • In contrast, NT01CX_1560 (UPF0059 family membrane protein) has an incompletely characterized function but may participate in membrane integrity or environmental sensing based on structural predictions.

    • Therapeutic synergy potential exists between these proteins, with NT01CX2047's liposome-disrupting activity potentially complementing other membrane-associated functions of NT01CX_1560.

  • Functional category comparison:

Membrane ProteinFunctional CategoryTherapeutic RelevanceCurrent Development Status
NT01CX_1560UPF0059 family membrane proteinPotential role in environmental sensing, membrane integrityEarly research phase, function being characterized
NT01CX2047 (Liposomase)Lipid-modifying enzymeEnhances delivery of liposomal drugs within tumorsAdvanced preclinical development, mechanism established
Bacterial flagellinsMotility proteinsTriggers immune recognition, potential immunomodulationStudied as adjuvants for anti-cancer immunity
Surface adhesinsAttachment proteinsMediates tumor cell interactions, potential targetingUnder investigation for enhanced tumor specificity
  • Targeting potential:

    • C. novyi-NT spores demonstrate remarkable tumor targeting ability, with studies showing approximately 95% of murine subjects exhibiting tumor mitigation following intravenous delivery, despite only about 1% of spores localizing to tumors .

    • The membrane proteome collectively contributes to this specificity, with NT01CX_1560 potentially participating in the adaptation to tumor microenvironments that allows selective germination and growth.

    • This selective targeting has significant therapeutic implications, as C. novyi-NT colonization has not been observed in other models of physiological hypoxia such as ischemia .

  • Combination therapy applications:

    • Studies combining C. novyi-NT with conventional chemotherapeutics (COBALT - combination bacteriolytic therapy) have shown significant enhancement of anti-tumor effects .

    • NT01CX_1560's role in this context remains to be fully elucidated but may contribute to the bacterium's ability to withstand chemotherapeutic stress while maintaining tumor colonization.

    • The impressive 100% tumor regression and 65% long-term survival observed with C. novyi-NT plus liposomal doxorubicin suggests membrane proteins collectively contribute to therapeutic efficacy.

Understanding the comparative functions of these membrane proteins provides direction for prioritizing engineering efforts and designing rational combination approaches for enhanced cancer therapy.

What are the potential applications of NT01CX_1560 beyond cancer therapy?

While cancer therapy applications have dominated research on Clostridium novyi-NT, the NT01CX_1560 membrane protein possesses characteristics that suggest broader potential applications across multiple fields. These emerging applications leverage both the protein's intrinsic properties and the biotechnological potential of its bacterial host:

  • Biosensing and environmental monitoring:

    • As a membrane protein potentially involved in environmental sensing, NT01CX_1560 could be engineered as a biosensor component for detecting specific analytes or environmental conditions.

    • Applications include monitoring anaerobic conditions in industrial bioprocesses, detecting soil contamination, or sensing metabolites indicative of disease states.

    • The protein's natural adaptation to anaerobic environments makes it particularly valuable for sensing in oxygen-limited settings where traditional approaches may be limited.

  • Bioremediation applications:

    • Clostridium species possess metabolic capabilities that enable degradation of various environmental contaminants.

    • NT01CX_1560 could be engineered to enhance cellular uptake or detection of specific pollutants, potentially improving the efficiency of bioremediation processes.

    • Target contaminants might include persistent organic pollutants, heavy metals, or agricultural runoff components.

  • Bioprocess technology:

    • Understanding membrane proteins like NT01CX_1560 contributes to improvements in anaerobic fermentation processes.

    • Applications include optimizing biofuel production, enhancing yields of high-value biochemicals, or improving stress tolerance in industrial microbial strains.

    • The protein could serve as a model for engineering improved membrane transport systems in industrial microorganisms.

  • Structural biology research:

    • As a member of the UPF0059 protein family with uncharacterized function, NT01CX_1560 represents an opportunity to expand knowledge of membrane protein biology.

    • High-resolution structural studies could provide insights into membrane protein folding, stability, and function relevant across biological systems.

    • This fundamental knowledge contributes to improved computational prediction of membrane protein structures and drug-target interactions.

  • Antimicrobial development:

    • Understanding bacterial membrane proteins provides targets for developing novel antimicrobials.

    • NT01CX_1560 could serve as a model for studying membrane vulnerabilities in pathogenic Clostridium species.

    • This research direction has particular relevance given the clinical importance of Clostridial infections and emerging antibiotic resistance.

These diverse applications highlight the value of fundamental research on proteins like NT01CX_1560, demonstrating how insights gained from cancer therapy research can translate to broader biotechnological and environmental applications.

What are the latest research developments regarding genetic modification of Clostridium novyi for enhancing NT01CX_1560 function?

Recent advances in genetic modification techniques for Clostridium novyi have opened new possibilities for enhancing NT01CX_1560 function in research and therapeutic applications. These developments build upon established methods while introducing novel approaches for precise genetic manipulation:

  • CRISPR/Cas9 implementation for C. novyi:

    • Successful application of CRISPR/Cas9 genome editing in C. novyi has transformed the precision with which genes like NT01CX_1560 can be modified.

    • Published protocols demonstrate the effectiveness of calcium competent transformation with complete CRISPR/Cas9 plasmids (pKMD002), with confirmation of successful genomic modification through restriction digest analysis showing characteristic doublet patterns .

    • This technology enables precise modifications including insertions, deletions, and point mutations to study structure-function relationships of NT01CX_1560.

  • Promoter engineering strategies:

    • Development of tunable promoter systems allows controlled expression of NT01CX_1560 and variant proteins.

    • Context-responsive promoters that activate specifically under tumor microenvironment conditions enhance the spatial and temporal precision of NT01CX_1560 expression.

    • Constitutive promoters with varying strengths provide tools for optimizing expression levels for different applications.

  • Heterologous gene transfer advancements:

    • Recent work has demonstrated successful heterologous gene transfer into C. novyi-NT, as evidenced by the successful expression of functional single-domain antibodies (VHH) against HIF-1α .

    • These techniques enable fusion of NT01CX_1560 with functional domains from other proteins to create chimeric proteins with enhanced or novel functions.

    • Similar approaches could be applied to engineer NT01CX_1560 variants incorporating targeting domains, enzymatic functions, or reporter elements.

  • Modified transformation protocols:

    • Enhanced transformation efficiency has been achieved through protocols incorporating oxygen-scavenging enzymes like Oxyrase during competent cell preparation .

    • Statistical analysis of these methods demonstrates significant improvements (p < 0.001) in transformation efficiency compared to traditional approaches .

    • These advances facilitate more rapid screening of NT01CX_1560 variants and accelerate the design-build-test cycle for protein engineering.

  • Enhanced genetic stability approaches:

    • Development of chromosomal integration techniques provides more stable expression compared to plasmid-based systems.

    • Selection marker recycling strategies allow sequential genetic modifications without accumulating antibiotic resistance genes.

    • Counterselection systems facilitate markerless genome modifications, reducing unintended effects on bacterial physiology.

These genetic modification advancements collectively provide a robust toolkit for engineering NT01CX_1560 variants with enhanced functions, stability, or novel capabilities. The continued refinement of these techniques promises to accelerate research on this and other membrane proteins in Clostridium novyi.

What are the current limitations in NT01CX_1560 research and potential strategies to address them?

Research on NT01CX_1560 faces several significant limitations that constrain both fundamental understanding and translational applications. Identifying these challenges and developing strategies to address them provides a roadmap for advancing the field:

  • Functional characterization gaps:

    • Current limitation: As a member of the UPF0059 protein family, the precise function of NT01CX_1560 remains incompletely characterized.

    • Strategy: Implementation of systematic phenotyping approaches using knockout, knockdown, and overexpression strains, combined with transcriptomic and proteomic profiling under relevant conditions.

    • Expected outcome: Identification of pathways and processes affected by NT01CX_1560 perturbation, providing functional context and potential therapeutic implications.

  • Structural knowledge limitations:

    • Current limitation: Lack of high-resolution structural data for NT01CX_1560 impedes structure-based design approaches.

    • Strategy: Multi-pronged structural biology approach combining computational prediction (AlphaFold2), X-ray crystallography of detergent-solubilized protein, and cryo-EM analysis in native-like lipid environments.

    • Expected outcome: Detailed structural models revealing functional domains, potential binding sites, and conformational dynamics relevant to membrane interactions.

  • In vivo tracking challenges:

    • Current limitation: Monitoring NT01CX_1560 expression and localization in vivo within tumor tissues remains technically challenging.

    • Strategy: Development of non-invasive imaging approaches using reporter fusions compatible with C. novyi-NT biology and implementation of single-cell transcriptomics to capture expression heterogeneity.

    • Expected outcome: Improved understanding of spatiotemporal expression patterns within tumors and correlation with therapeutic efficacy.

  • Translation to clinically relevant models:

    • Current limitation: Most studies have utilized murine models, with limited data in models more predictive of human response.

    • Strategy: Expansion to patient-derived xenograft models, companion animal studies with spontaneous tumors, and ex vivo human tumor explant systems to validate findings in more complex and relevant contexts.

    • Expected outcome: Enhanced predictive value of preclinical studies and identification of potential biomarkers for patient stratification.

  • Interdisciplinary knowledge integration:

    • Current limitation: Fragmentation between engineering, biological, and clinical research communities limits cross-fertilization of ideas.

    • Strategy: Establishment of collaborative consortia bringing together experts from structural biology, synthetic biology, cancer biology, and clinical oncology focused on C. novyi-NT proteins including NT01CX_1560.

    • Expected outcome: Accelerated translation through integration of diverse expertise and coordinated research priorities.

Addressing these limitations requires sustained investment in both fundamental and translational research, with particular emphasis on developing improved tools for genetic manipulation and protein characterization within the challenging context of obligate anaerobic bacteria.

What are the critical factors for researchers to consider when designing experiments involving NT01CX_1560?

Researchers designing experiments involving NT01CX_1560 must consider several critical factors to ensure valid, reproducible, and translatable results. These considerations span technical challenges, biological complexities, and experimental design principles:

  • Anaerobic conditions maintenance:

    • Critical factor: C. novyi is an obligate anaerobe, requiring strict oxygen exclusion throughout experimental procedures.

    • Implementation: Utilize established protocols combining atmospheric chambers with oxygen-fixing enzymes and monitor oxygen levels continuously.

    • Validation approach: Include appropriate controls (facultative anaerobes) to verify anaerobic conditions and assess potential oxygen exposure effects on results.

  • Genetic stability considerations:

    • Critical factor: Ensuring consistent expression and stable genetic modifications across experimental timeframes.

    • Implementation: Regular verification of genetic constructs through sequencing and functional assays, particularly after multiple passages.

    • Validation approach: Include wild-type controls in parallel with modified strains and assess for phenotypic drift.

  • Model system relevance:

    • Critical factor: Selection of experimental models that recapitulate relevant aspects of intended applications.

    • Implementation: For cancer applications, prioritize models with appropriate hypoxic gradients and immunological components rather than simplified in vitro systems.

    • Validation approach: Compare results across multiple model systems to identify consistent biological principles versus model-specific artifacts.

  • Physiologically relevant expression levels:

    • Critical factor: Avoiding misinterpretation due to non-physiological overexpression artifacts.

    • Implementation: Employ titratable expression systems and compare with native expression levels quantified by targeted proteomics.

    • Validation approach: Correlate phenotypic outcomes with protein expression levels to establish dose-response relationships.

  • Microenvironmental condition standardization:

    • Critical factor: C. novyi behavior and protein expression are highly sensitive to environmental conditions.

    • Implementation: Comprehensive documentation and standardization of media components, pH, temperature, and growth phase.

    • Validation approach: Include environmental parameter monitoring in experimental datasets and report all relevant conditions in publications.

  • Appropriate controls for membrane protein studies:

    • Critical factor: Distinguishing specific NT01CX_1560 effects from general membrane perturbations.

    • Implementation: Include controls with other membrane proteins of similar size/topology but different function.

    • Validation approach: Parallel testing of multiple protein variants with defined mutations to establish structure-function relationships.

  • Translational potential assessment:

    • Critical factor: Designing experiments that inform therapeutic development rather than isolated mechanistic studies.

    • Implementation: Include clinically relevant endpoints and assessment criteria that align with potential therapeutic applications.

    • Validation approach: Engage clinical collaborators early to ensure experimental designs address translational questions.

Careful consideration of these factors during experimental design enhances the scientific validity and translational value of research involving NT01CX_1560, while reducing the risk of artifacts or irreproducible findings.

What emerging technologies might transform our understanding of NT01CX_1560 in the next decade?

The next decade promises significant technological advancements that will likely transform our understanding of NT01CX_1560 and similar bacterial membrane proteins. These emerging technologies span multiple disciplines and offer unprecedented capabilities for analysis, manipulation, and application:

  • Advanced structural biology approaches:

    • Cryo-electron tomography: Enabling visualization of NT01CX_1560 in its native membrane context within intact bacterial cells, revealing spatial organization and protein-protein interactions at near-atomic resolution.

    • Integrative structural biology: Combining multiple data sources (crystallography, NMR, mass spectrometry, molecular dynamics) through computational frameworks to generate comprehensive structural models capturing dynamic behavior.

    • Serial femtosecond crystallography: Using X-ray free electron lasers to determine structures from microcrystals of membrane proteins like NT01CX_1560 without radiation damage, potentially revealing previously inaccessible conformational states.

  • Single-cell and spatial technologies:

    • Single-bacterium proteomics: Quantifying NT01CX_1560 expression at the individual cell level, revealing heterogeneity within bacterial populations colonizing tumors.

    • Spatial transcriptomics/proteomics: Mapping expression patterns within tumor microenvironments with subcellular resolution, correlating NT01CX_1560 expression with local environmental factors.

    • Live cell protein tracking: Monitoring NT01CX_1560 dynamics in real-time within living bacteria using minimally perturbative tags and advanced microscopy techniques.

  • Synthetic biology advancements:

    • Cell-free protein expression systems: Enabling rapid prototyping of NT01CX_1560 variants without constraints of bacterial cultivation.

    • Genome-scale engineering: Comprehensive modification of interaction networks surrounding NT01CX_1560 to elucidate functional relationships.

    • Engineered protein scaffolds: Creating synthetic membrane environments optimized for NT01CX_1560 function and analysis.

  • Advanced computational approaches:

    • Quantum computing applications: Enabling previously infeasible simulations of membrane protein dynamics at biologically relevant timescales.

    • Artificial intelligence-driven protein design: Generating NT01CX_1560 variants with enhanced stability, specificity, or novel functions based on deep learning across protein structure databases.

    • Multi-scale modeling: Integrating molecular, cellular, and tissue-level simulations to predict NT01CX_1560 behavior across different contexts.

  • In vivo analysis technologies:

    • Implantable biosensors: Real-time monitoring of bacterial activity and protein expression within living subjects.

    • Advanced imaging modalities: Non-invasive visualization of bacterial localization and function with improved resolution and sensitivity.

    • Extracellular vesicle analysis: Studying bacterial membrane protein incorporation into vesicles as biomarkers and potential therapeutic delivery vehicles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.