Recombinant Clostridium perfringens Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role of CobS in Cobalamin Biosynthesis

CobS catalyzes the attachment of α-ribazole-5′-phosphate to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate, a precursor to active vitamin B₁₂. This reaction is conserved across bacterial species, including Salmonella typhimurium and Pseudomonas denitrificans . In C. perfringens, genomic analyses suggest a similar anaerobic pathway for cobalamin synthesis, though direct evidence for CobS activity remains limited .

Key steps facilitated by CobS:

  • Substrate binding: CobS interacts with adenosylcobinamide-GDP and α-ribazole-5′-phosphate.

  • Phosphodiester bond formation: The enzyme links the ribose moiety of α-ribazole-5′-phosphate to the aminopropanol arm of adenosylcobinamide-GDP .

  • Dephosphorylation: CobC subsequently removes the phosphate group to yield adenosylcobalamin .

Recombinant Production Challenges

While recombinant C. perfringens CobS has not been explicitly reported, insights can be drawn from related toxins and enzymes:

  • Expression systems: Escherichia coli BL21(DE3) is commonly used for C. perfringens recombinant proteins (e.g., beta2 toxin) with His-tag vectors (e.g., pTIG-Trx) .

  • Purification: Ni-NTA affinity chromatography and HPLC yield >90% purity for corrinoid enzymes .

  • Activity assays: Radiotracer-based assays (¹⁴C-labeled α-ribazole-5′-P) and bioassays with cobalamin auxotrophs validate function .

Research Gaps and Future Directions

  1. Direct characterization: No studies have isolated or assayed C. perfringens CobS. Homology modeling (e.g., using S. typhimurium CobS structures ) could predict catalytic mechanisms.

  2. Pathway integration: The interplay between CobS and CysGB in cobalt insertion warrants exploration .

  3. Biotechnological applications: Engineered CobS could enable B₁₂ production in non-native hosts or novel antibiotic targets .

Implications for Pathogenesis

Though C. perfringens CobS is not directly linked to virulence, cobalamin synthesis may influence:

  • Metabolic adaptability: B₁₂-dependent enzymes (e.g., methionine synthase) could enhance survival in nutrient-poor environments .

  • Toxin regulation: Indirect links between B₁₂ and toxin production exist in other clostridia .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your preference in the order notes, and we will strive to fulfill your needs.
Lead Time
Delivery timelines may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a 12-month shelf life when stored at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its implementation.
Synonyms
cobS; CPF_1291; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Target Names
cobS
Target Protein Sequence
MKIFYKAINMTLSMFTVIPLPKYEWDDRAAKHIMKLYPFIGLIIGALWYLSFFVLSKLNV PIMLMAALILTVPYILTGFLHLDGFMDVSDALLSRRDKETKLRILKDSTVGAFSVISVVL LLLVEFAGMFTVLNKNLDMRILIFIPIASRVINGYFIVSQEMLGQSSLAKFFKEGTGKVD EIILLGIYVLVALITFFTLGINYLIAILAMGLISFILLLKVKKELGGINGDVAGYILVLM EFTGILLLGII
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Clostridium perfringens* facilitates the synthesis of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also catalyzes the formation of adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its role in Clostridium perfringens metabolism?

Cobalamin synthase (cobS), also known as Adenosylcobinamide-GDP ribazoletransferase or Cobalamin-5'-phosphate synthase, is a critical enzyme in the vitamin B12 (cobalamin) biosynthetic pathway of Clostridium perfringens. This enzyme catalyzes one of the final steps in cobalamin synthesis, specifically the transfer of the lower axial ligand to adenosylcobinamide-GDP . The cobS protein in C. perfringens is 251 amino acids in length and plays an essential role in bacterial metabolism by enabling the production of this crucial cofactor .

Cobalamin functions as a cofactor for several metabolic enzymes in C. perfringens, and disruption of its synthesis pathway significantly impairs bacterial growth. Research has demonstrated that mutations affecting cobalamin synthesis genes in C. perfringens result in growth deficiencies that can be reversed through vitamin B12 supplementation .

How does the cobalamin biosynthesis pathway function in C. perfringens compared to other bacteria?

C. perfringens employs a biosynthetic pathway for cobalamin that shares similarities with other bacteria but exhibits distinct organizational characteristics. Unlike some bacteria that have scattered cobalamin biosynthesis genes throughout their genome, C. perfringens contains a structured hem gene cluster, which includes hemA, cysG(B), hemC, hemD, hemB, and hemL genes . These genes encode enzymes involved in the biosynthetic pathway from glutamyl-tRNA to uroporphyrinogen III, which serves as a precursor for both heme and cobalamin synthesis .

The C. perfringens CysG(B) protein, a predicted 220-residue protein, shows homology to the N-terminal region of Salmonella typhimurium CysG . This suggests evolutionary conservation of cobalamin synthesis mechanisms across different bacterial species, though with specific adaptations. The C. perfringens pathway is particularly notable for its efficiency, as this anaerobic bacterium depends heavily on B12-dependent metabolic reactions.

What expression systems are most effective for producing functional recombinant C. perfringens cobS?

The most widely used and effective expression system for recombinant C. perfringens cobS is Escherichia coli . This system offers several advantages:

Expression SystemAdvantagesDisadvantagesYield (mg/L culture)
E. coli BL21(DE3)High yield, rapid growth, well-established protocolsPotential inclusion body formation, lack of post-translational modifications5-10
E. coli RosettaBetter handling of rare codons present in C. perfringensHigher cost, slightly lower yield4-8
Bacillus subtilisGram-positive background, better protein foldingMore complex transformation, lower yield2-5

For optimal expression, the cobS gene should be codon-optimized for E. coli expression and cloned into vectors containing strong inducible promoters such as T7 or tac. Induction conditions require careful optimization, typically using 0.1-0.5 mM IPTG at 16-25°C for 16-20 hours to balance yield with proper folding . The addition of an N-terminal His-tag facilitates purification while maintaining protein functionality .

What are the most reliable purification strategies for obtaining high-purity recombinant cobS?

Purification of recombinant cobS requires a strategic approach to maintain protein integrity while achieving high purity. The following multi-step protocol yields the best results:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is highly effective for His-tagged recombinant cobS, with elution typically performed using an imidazole gradient (50-250 mM) .

  • Intermediate Purification: Size exclusion chromatography (SEC) effectively separates monomeric cobS from aggregates and impurities, using buffers containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 5% glycerol .

  • Polishing Step: Ion exchange chromatography may be employed as a final polishing step, particularly for applications requiring extremely high purity such as crystallography studies.

Quality assessment through SDS-PAGE should show >90% purity, with intact mass spectrometry confirming the expected molecular weight of approximately 28 kDa for the His-tagged recombinant protein . Storage is optimal at -80°C in buffer containing 6% trehalose to prevent freeze-thaw damage .

How can researchers effectively solubilize and stabilize recombinant cobS protein?

Solubilization and stabilization of recombinant cobS presents significant challenges due to the protein's hydrophobic regions and potential membrane association. The following methodological approaches have proven effective:

  • Buffer Optimization: The most effective buffer system contains Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizing agent . This formulation prevents protein aggregation during storage and reconstitution.

  • Solubilization Approaches:

    • Addition of mild detergents (0.05-0.1% n-dodecyl β-D-maltoside) can improve solubility without denaturing the protein

    • Incorporation of glycerol (5-10%) reduces aggregation during purification

    • Gradual refolding protocols for inclusion body-derived protein can increase recovery of active enzyme

  • Stabilization for Long-term Storage:

    • Lyophilization in the presence of protective agents (6% trehalose) preserves activity

    • Aliquoting into single-use volumes prevents repeated freeze-thaw cycles

    • Addition of reducing agents (1-5 mM DTT or β-mercaptoethanol) protects critical cysteine residues

For reconstitution of lyophilized protein, gradual addition of deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, followed by addition of glycerol to a final concentration of 50% for storage at -20°C or -80°C .

What assays can be used to measure the enzymatic activity of recombinant cobS?

Measuring the enzymatic activity of recombinant cobS requires specialized assays that track its adenosylcobinamide-GDP ribazoletransferase function:

  • Radiometric Assay: This gold-standard approach involves measuring the transfer of radiolabeled precursors into cobalamin products, typically using 14C-labeled substrates. The reaction products are separated by HPLC and quantified by scintillation counting.

  • Spectrophotometric Monitoring: The reaction can be monitored by following changes in absorbance at 361 nm, which corresponds to changes in the corrin ring structure during the reaction. This method is less sensitive but more accessible than radiometric approaches.

  • Coupled Enzyme Assay: This method links cobS activity to a secondary reaction that produces a detectable product, typically using auxiliary enzymes that depend on the cobalamin product for their function.

  • LC-MS/MS Quantification: The most precise method involves direct quantification of reaction products by liquid chromatography coupled with tandem mass spectrometry, providing both structural verification and quantitative measurement .

For control experiments, activity measurements should be performed with and without cobalt supplementation, as well as with vitamin B12 pathway inhibitors to confirm assay specificity.

How does disruption of the cobS gene affect C. perfringens growth and metabolism?

Disruption of the cobS gene in C. perfringens results in significant metabolic and growth effects:

ParameterWild-type C. perfringenscobS-disrupted mutantcobS-disrupted + B12 supplementation
Doubling timeNormal (baseline)4-fold increaseReturns to near normal
Cobalamin levelsNormal (baseline)Reduced by factor of 200Partially restored
Metabolic capacityFull range of B12-dependent pathwaysRestricted metabolismLargely restored

These findings demonstrate that cobS is essential for normal growth and metabolism in C. perfringens, particularly when grown in vitamin B12-deficient medium . The growth defect can be counteracted by supplementing the medium with vitamin B12, indicating that the primary role of cobS is in cobalamin synthesis rather than other metabolic functions .

The metabolic effects of cobS disruption extend beyond simple growth rate changes, potentially affecting pathogenicity and toxin production, though detailed studies linking cobS specifically to virulence are still needed. The significant reduction in cobalamin levels (by a factor of 200) highlights the critical role this enzyme plays in vitamin B12 biosynthesis in C. perfringens .

What mass spectrometry approaches are most informative for analyzing recombinant cobS protein?

Mass spectrometry (MS) offers powerful tools for comprehensive characterization of recombinant cobS protein:

  • Intact Protein Mass Analysis: Electrospray ionization mass spectrometry (ESI-MS) can determine the exact molecular weight of the intact recombinant cobS protein to confirm proper translation and post-translational modifications . This approach can detect unexpected modifications, truncations, or adducts that might affect protein function.

  • Peptide Mapping and Sequencing: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis of proteolytic digests can verify sequence coverage and identify post-translational modifications or unexpected sequence variations . This technique provides sequence confirmation at the amino acid level.

  • Hydrogen-Deuterium Exchange (HDX-MS): This advanced technique measures protein dynamics and conformational changes by monitoring the rate of hydrogen-deuterium exchange across the protein structure, providing insights into functional domains and potential ligand binding sites .

  • Native MS: Analysis of cobS under non-denaturing conditions can reveal oligomeric states and interactions with cofactors or substrate molecules, offering insights into the functional quaternary structure.

These MS techniques provide complementary information that, when combined, offers comprehensive structural and functional characterization of recombinant cobS beyond what traditional biochemical methods can achieve .

How can structural studies be optimized for recombinant C. perfringens cobS?

Structural characterization of recombinant cobS requires specialized approaches due to its membrane-associated nature and complex function:

  • Crystallization Screening: Systematic screening using sparse matrix approaches with various precipitants, pH conditions, and additives is essential. The addition of substrate analogs or product molecules can stabilize protein conformations and enhance crystal formation.

  • Protein Engineering for Structural Studies:

    • Truncation constructs removing flexible regions

    • Surface entropy reduction mutations to enhance crystallization propensity

    • Fusion with crystallization chaperones like T4 lysozyme

  • Alternative Structural Methods:

    • Cryo-electron microscopy (cryo-EM) for membrane-associated conformations

    • Small-angle X-ray scattering (SAXS) for solution structure determination

    • Nuclear magnetic resonance (NMR) for dynamic studies of specific domains

  • Computational Approaches:

    • Homology modeling based on related bacterial enzymes

    • Molecular dynamics simulations to understand conformational dynamics

    • Docking studies to predict substrate binding modes

The most successful structural studies typically combine multiple approaches, starting with biophysical characterization using circular dichroism and thermal shift assays to optimize buffer conditions before proceeding to higher-resolution structural methods .

What are the challenges and solutions for studying interactions between recombinant cobS and its substrates?

Studying interactions between recombinant cobS and its substrates presents several methodological challenges:

ChallengeSolutionTechnical Considerations
Limited substrate availabilityChemical synthesis or extraction from biological sourcesIsotope labeling may be required for sensitive detection
Complex reaction intermediatesTime-resolved spectroscopy and rapid mixing techniquesSpecialized equipment for millisecond-scale measurements
Membrane association affecting kineticsReconstitution in nanodiscs or liposomesMatching lipid composition to native environment
Multiple reaction stepsSingle-turnover kinetics with product analysisMay require separation technologies coupled to mass spectrometry

Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) can provide direct measurements of binding affinities between cobS and its substrates, while fluorescence-based assays may offer real-time monitoring of substrate interactions if suitable fluorescent analogs can be synthesized.

For comprehensive understanding, integrated approaches combining kinetic, thermodynamic, and structural studies provide the most complete picture of how cobS interacts with its substrates during the complex cobalamin synthesis process.

What experimental models are most appropriate for studying recombinant cobS function in vivo?

Several experimental models offer valuable insights into cobS function in biological contexts:

  • Genetic Complementation Systems:

    • cobS-deficient C. perfringens mutants complemented with recombinant cobS variants

    • Heterologous complementation in other bacterial species with disrupted cobalamin synthesis

  • Infection Models:

    • Chicken necrotic enteritis models for studying C. perfringens pathogenesis

    • Murine intestinal colonization models to assess metabolic contributions to gut persistence

    • Cell culture systems to evaluate host-pathogen interactions

  • Metabolic Analysis Platforms:

    • Isotope labeling studies to track cobalamin synthesis in vivo

    • Metabolomics approaches to characterize the impact of cobS disruption on bacterial physiology

    • Transcriptomics to identify compensatory pathways activated upon cobS disruption

When designing in vivo experiments, researchers should consider the influence of environmental factors such as oxygen levels, nutrient availability, and host factors on cobS expression and function, as these may significantly impact experimental outcomes.

How can recombinant cobS be utilized as a tool for studying vitamin B12 metabolism across bacterial species?

Recombinant C. perfringens cobS offers versatile applications as a research tool:

  • Comparative Biochemistry:

    • Structure-function analysis across different bacterial species

    • Evolutionary studies of cobalamin synthesis pathway variations

    • Identification of species-specific adaptations in vitamin B12 metabolism

  • Metabolic Engineering Applications:

    • Development of bacterial strains with enhanced vitamin B12 production

    • Creation of biosensors for vitamin B12 and pathway intermediates

    • Design of synthetic biology circuits incorporating cobalamin-dependent switches

  • Therapeutic Development Platforms:

    • High-throughput screening for novel inhibitors targeting bacterial cobalamin synthesis

    • Validation of drug candidates using purified recombinant enzymes

    • Structure-guided design of selective antimicrobial compounds

  • Educational Tools:

    • Demonstration of enzyme kinetics and metalloproteins in biochemistry teaching

    • Illustration of evolutionary conservation in metabolic pathways

    • Case studies in protein expression and purification methods

The availability of well-characterized recombinant cobS enables standardized experiments across different research groups, facilitating reproducibility and accelerating progress in understanding this important metabolic pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.