Recombinant Clostridium perfringens Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscL; CPR_0163; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Clostridium perfringens (strain SM101 / Type A)
Target Names
mscL
Target Protein Sequence
MWKEFKEFAMKGNVIDLAIGVIIGGAFGKIVTSLVNDIIMPVIGRLVGKVDFSNLYINLS GQQFNSLQEAQAAGAATINYGLFLNNLINFLIIAFSIFIVIKQINKLKNFTKKKEEVQVE ATEKDCPYCCTKIDIKATRCPHCTSVLEEATNQSS
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links

KEGG: cpr:CPR_0163

Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the large-conductance mechanosensitive channel (MscL) and what is its role in bacterial physiology?

MscL is a membrane protein that forms a non-selective ion channel activated by membrane tension. It functions primarily as a protective mechanism against osmotic shock by allowing rapid efflux of cytoplasmic solutes when bacteria experience hypoosmotic stress. The channel exhibits large conductance (approximately 3 nS) and is characterized by its ability to sense and respond to mechanical forces in the cell membrane . In bacterial species like C. perfringens, which can colonize diverse environments including soil and the intestinal tract, MscL likely plays a crucial role in environmental adaptation and survival under rapidly changing osmotic conditions .

How do mechanosensitive channels in C. perfringens potentially contribute to its pathogenicity?

While direct evidence linking C. perfringens MscL to virulence is limited, mechanosensitive channels could potentially contribute to pathogenicity by:

  • Facilitating bacterial survival during osmotic transitions encountered in host environments

  • Contributing to membrane stability during toxin production and secretion

  • Potentially aiding in resistance against host defense mechanisms

C. perfringens is known to produce over 16 different toxins that target host cell membranes in various ways . The bacterium's ability to maintain membrane integrity during toxin production and secretion, potentially supported by mechanosensitive channels, may enhance its virulence during both histotoxic and intestinal infections.

What expression systems are most effective for producing recombinant bacterial MscL proteins?

Based on established protocols for E. coli MscL, effective expression systems for recombinant bacterial mechanosensitive channels typically involve:

  • Fusion protein approaches: Expression as a fusion protein with glutathione S-transferase (GST) has been successfully demonstrated for E. coli MscL . This approach facilitates purification and can enhance protein stability.

  • Host selection: Expression in a bacterial strain containing a disruption in the chromosomal MscL gene is advantageous to avoid interference from native protein .

  • Inducible promoter systems: These allow controlled expression to minimize potential toxicity of membrane protein overexpression.

While specific data for C. perfringens MscL expression is not provided in the search results, these general principles would likely apply, with modifications to account for the specific characteristics of the C. perfringens protein.

What purification strategies yield functional recombinant MscL for experimental studies?

For functional purification of recombinant MscL:

  • Affinity chromatography: Glutathione-coated beads have been successfully used for GST-fusion MscL proteins .

  • Proteolytic cleavage: Thrombin cleavage has been employed to recover the MscL protein from fusion constructs .

  • Detergent selection: Appropriate detergents are critical for maintaining membrane protein structure during purification.

  • Quality control: Validation of protein integrity through SDS-PAGE and Western blotting with antibodies against MscL or affinity tags.

These approaches have yielded functional E. coli MscL suitable for reconstitution and electrophysiological studies, suggesting similar strategies may be applicable to C. perfringens MscL .

What are the optimal conditions for functional reconstitution of recombinant MscL in artificial liposomes?

Functional reconstitution of MscL requires careful attention to:

  • Lipid composition: Phosphatidylcholine and phosphatidylethanolamine mixtures are commonly used to create artificial liposomes that support MscL function .

  • Protein-to-lipid ratio: Typically ranges from 1:200 to 1:1000 (w/w) to ensure proper channel density.

  • Reconstitution method: Detergent dilution or dialysis approaches have been successfully employed for MscL incorporation into liposomes .

  • Buffer conditions: pH and ionic strength must be optimized to maintain protein stability and function during reconstitution.

These parameters should be systematically tested when working with C. perfringens MscL to identify optimal reconstitution conditions.

How can researchers validate the functionality of reconstituted recombinant MscL?

Validation of reconstituted MscL functionality can be accomplished through:

  • Patch-clamp electrophysiology: This technique directly measures channel conductance and pressure sensitivity, confirming channel functionality in artificial membranes .

  • Characteristic conductance measurement: Functional E. coli MscL exhibits approximately 3 nS conductance, providing a reference point for evaluating C. perfringens MscL .

  • Pressure sensitivity assessment: Functional channels should exhibit the characteristic pressure-dependent gating observed in native membranes .

  • Inhibitor response: Gadolinium, a known mechanosensitive ion channel inhibitor, should block reconstituted MscL activity .

  • Antibody inhibition: Specific antibodies against MscL can abolish channel activity when preincubated with the protein, providing another verification approach .

What electrophysiological approaches are most informative for characterizing recombinant MscL properties?

For detailed characterization of recombinant MscL:

  • Single-channel patch-clamp: Excised patch configurations provide direct measurement of:

    • Single-channel conductance

    • Pressure threshold for activation

    • Channel gating kinetics

    • Subconductance states

  • Pressure-clamp protocols: Applying defined pressure steps allows determination of:

    • Pressure-response relationship

    • Channel adaptation properties

    • Opening and closing rates as a function of membrane tension

  • Ion selectivity determination: By varying ion concentrations and measuring reversal potentials, the relative permeability to different ions can be established.

For C. perfringens MscL, these approaches would reveal its biophysical properties and allow comparison with the better-characterized E. coli MscL .

How do structure-function analyses contribute to understanding MscL gating mechanisms?

Structure-function studies provide critical insights into MscL gating through:

  • Site-directed mutagenesis: Identifying residues critical for:

    • Pressure sensing

    • Channel gating

    • Ion conductance

    • Interaction with inhibitors like gadolinium

  • Cysteine accessibility experiments: Using thiol-reactive compounds to probe conformational changes during channel opening.

  • Structural modeling: Homology modeling based on available bacterial MscL structures can help predict critical domains in C. perfringens MscL.

  • Chimeric channel construction: Creating chimeras between E. coli and C. perfringens MscL components can identify domains responsible for functional differences.

What strategies are most effective for generating functional antibodies against MscL?

Based on successful approaches with E. coli MscL :

  • Immunogen preparation: Purified recombinant MscL protein is an effective immunogen for generating polyclonal antibodies .

  • Adjuvant selection: Critical for enhancing immunogenicity of membrane proteins while maintaining native conformation.

  • Screening methods:

    • ELISA against purified protein

    • Western blotting to confirm specificity

    • Functional testing via patch-clamp to identify antibodies that modulate channel function

  • Monoclonal versus polyclonal approaches: Both strategies have merits, with polyclonal antibodies providing broader epitope recognition while monoclonals offer higher specificity.

The successful generation of function-blocking polyclonal antibodies against E. coli MscL suggests similar approaches could work for C. perfringens MscL .

How can anti-MscL antibodies be utilized in functional studies?

Anti-MscL antibodies can be powerful tools:

  • Channel inhibition studies: Antibodies that block channel activity can be used to study the physiological roles of MscL .

  • Localization experiments: Immunofluorescence microscopy to determine subcellular distribution of MscL.

  • Co-immunoprecipitation: Identifying potential interaction partners of MscL in C. perfringens.

  • Expression level assessment: Quantifying MscL expression under different growth conditions or stress situations.

  • Structural studies: Antibody fragments can stabilize specific conformations for structural analysis.

These applications could provide valuable insights into the role of MscL in C. perfringens physiology and potentially pathogenicity .

How does C. perfringens MscL compare with mechanosensitive channels from other bacterial species?

While specific comparative data is not provided in the search results, key considerations include:

  • Sequence homology analysis: Determining the degree of conservation between C. perfringens MscL and well-characterized channels from E. coli and other bacteria .

  • Functional comparison:

    • Conductance properties

    • Pressure sensitivity thresholds

    • Gating kinetics

    • Pharmacological sensitivity

  • Physiological context: Unlike E. coli, C. perfringens is an anaerobic pathogen with a complex toxin arsenal , which may influence the evolutionary pressures on its MscL function.

  • Genomic context: Analysis of the genomic neighborhood of the MscL gene in C. perfringens compared to other species can provide insights into its regulation and potential co-expression with virulence factors.

What insights from E. coli MscL studies are applicable to C. perfringens MscL research?

The extensive research on E. coli MscL provides valuable guidelines for C. perfringens MscL studies:

  • Expression and purification protocols: The GST-fusion approach and subsequent purification methods demonstrated for E. coli MscL provide a starting framework.

  • Functional reconstitution methods: The liposome reconstitution approach and patch-clamp validation techniques can be adapted .

  • Biophysical characterization approaches: Protocols for assessing conductance, pressure sensitivity, and inhibitor responses can be transferred with appropriate modifications .

  • Antibody generation strategy: The successful production of function-blocking antibodies against E. coli MscL suggests similar approaches may work for C. perfringens MscL .

How might MscL contribute to C. perfringens survival in diverse environments?

C. perfringens is ubiquitous in the environment and colonizes diverse niches from soil to the intestinal tract . MscL likely contributes to this adaptability through:

  • Osmotic stress protection: Allowing rapid adaptation to changing osmotic conditions encountered during host colonization.

  • Membrane integrity maintenance: Supporting bacterial survival during exposure to host defense mechanisms or antimicrobial compounds.

  • Potential coordination with toxin production: C. perfringens produces numerous toxins that target host cell membranes . MscL might play a role in maintaining bacterial membrane integrity during toxin production and secretion.

  • Sporulation support: C. perfringens forms spores, and MscL could potentially contribute to membrane remodeling during sporulation or germination.

Is there potential cross-talk between MscL and toxin production pathways in C. perfringens?

C. perfringens produces an arsenal of at least 16 different toxins that mediate various aspects of pathogenesis . Potential interactions between MscL and toxin pathways might include:

  • Membrane stress sensing: MscL could potentially sense membrane perturbations associated with toxin secretion.

  • Metabolic coordination: Osmotic adaptation through MscL might be coordinated with metabolic shifts associated with toxin production.

  • Environmental sensing: MscL activation might serve as a signal that influences toxin expression under specific conditions.

  • Secretion support: MscL's role in membrane tension regulation could potentially support efficient toxin secretion.

While direct evidence for these interactions is not provided in the search results, they represent intriguing possibilities for future research considering C. perfringens' sophisticated toxin arsenal and its adaptation to diverse environments .

What genetic tools are most appropriate for studying MscL function in C. perfringens?

For genetic manipulation of C. perfringens to study MscL:

  • Gene knockout approaches: Creating MscL-deficient strains to assess phenotypic changes including:

    • Osmotic stress tolerance

    • Toxin production efficiency

    • Colonization ability

    • Sporulation efficiency

  • Controlled expression systems: Developing inducible promoters suitable for C. perfringens to modulate MscL expression levels.

  • Reporter fusions: Creating MscL-reporter fusions to monitor expression patterns under various conditions.

  • Complementation studies: Reintroducing wild-type or mutant MscL into knockout strains to confirm phenotypes and assess structure-function relationships.

These approaches would need to be adapted to the specific genetic tools available for C. perfringens manipulation.

What experimental design considerations are critical when investigating potential links between MscL and virulence?

When investigating MscL's potential role in C. perfringens virulence:

  • Relevant infection models: Select models that represent C. perfringens' diverse disease manifestations:

    • Histotoxic infections (gas gangrene)

    • Intestinal infections with diverse toxin profiles

    • Food poisoning scenarios

  • Environmental conditions: Test conditions that reflect the diverse environments C. perfringens encounters:

    • Anaerobic conditions

    • Varying osmolarity

    • Presence of host factors

  • Control strains: Include appropriate toxin-deficient mutants alongside MscL mutants to distinguish MscL-specific effects from those mediated by established virulence factors.

  • Mechanistic assessments: Develop methods to measure:

    • Membrane integrity during toxin production

    • Osmotic adaptation during infection progression

    • MscL expression patterns during pathogenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.