Recombinant Clostridium perfringens Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; CPF_1284; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Target Names
crcB
Target Protein Sequence
MQKLLLALIVGLGGFLGASLRYLISIFAAKNFGGNFPYGTLIANILGALLIGFIMEFSMD SALISSNMKLFLTTGIMGGLTTFSTFSYETISMLTNGNITLGIENIILNLGCSLLFVVIG QKLARILF
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant C. perfringens proteins?

Escherichia coli BL21 (DE3) has proven to be an effective expression system for recombinant C. perfringens proteins. This strain supports high-level expression when used with appropriate vectors such as pET30a or pET-24a(+). For optimal expression, consider the following protocol:

  • Culture transformed E. coli BL21 (DE3) cells at 37°C at 180 rpm in Luria-Bertani (LB) medium with appropriate antibiotic (e.g., 30 mg/mL kanamycin for pET30a vector)

  • Induce protein expression with 0.5 mM IPTG when OD600 reaches 0.6-0.8

  • Test multiple induction conditions (e.g., 37°C for 4 hrs vs. 15°C for 16 hrs) to determine optimal soluble protein yield

Research with CPB derivatives shows that induction temperature can significantly impact protein solubility, with lower temperatures (15°C) often yielding greater proportions of soluble protein compared to standard temperatures (37°C) .

How can I improve the solubility of recombinant C. perfringens proteins?

Solubility challenges are common when expressing C. perfringens proteins. Several strategies have proven effective:

  • Fusion tags: The addition of a SUMO (Small Ubiquitin-like Modifier) tag has been shown to significantly enhance solubility. For example, while untagged recombinant CPBm4 was primarily expressed in insoluble form, SUMO-tagged CPBm4 (rSUMO-CPBm4) showed improved solubility with approximately 17% soluble expression when induced at 15°C .

  • Temperature optimization: Lower induction temperatures (15°C) combined with longer induction times (16 hrs) can dramatically improve soluble protein yield compared to standard conditions (37°C for 4 hrs) .

  • Codon optimization: Adapting the gene sequence to E. coli codon preferences has been shown to improve expression efficiency and potentially solubility .

What purification approaches are most effective for His-tagged C. perfringens proteins?

For His-tagged recombinant C. perfringens proteins, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin has proven highly effective. The following protocol has been successfully employed:

  • Collect bacterial cells by centrifugation after induction

  • Resuspend and lyse cells by sonication in appropriate buffer

  • Separate soluble and insoluble fractions by centrifugation

  • Apply the soluble fraction to a Ni-NTA column

  • Wash extensively to remove non-specifically bound proteins

  • Elute target protein with buffer containing high imidazole concentration (500 mM)

Using this approach, researchers have successfully purified recombinant C. perfringens proteins to concentrations of 0.99-1.62 mg/mL with good purity as confirmed by SDS-PAGE and Western blot analysis .

How can site-directed mutagenesis be applied to generate non-toxic variants of C. perfringens proteins while preserving immunogenicity?

Site-directed mutagenesis represents a powerful approach for detoxifying C. perfringens proteins while maintaining their immunogenic properties. This strategy has been successfully demonstrated with C. perfringens beta toxin (CPB):

  • Multiple amino acid substitutions (R212E, Y266A, L268G, and W275A) were introduced into the CPB sequence to generate a non-toxic variant (CPBm4) .

  • The modified protein showed complete loss of toxicity in vivo, with no toxic effects observed in mice even at doses of 6,250 μg/kg, compared to wild-type CPB which has an LD50 of 0.4 μg/kg .

  • Despite these modifications, the detoxified protein maintained key antigenic epitopes, as demonstrated by recognition with polyclonal antibodies against crude CPB in Western blot analysis .

  • The non-toxic variant successfully induced protective immunity when used as a vaccine antigen, particularly when expressed with a SUMO tag (rSUMO-CPBm4) .

What computational approaches can aid in identifying novel C. perfringens protein candidates for vaccine development?

Computational approaches, particularly Comparative Subtractive Reverse Vaccinology (CSRV), have proven valuable for identifying potential vaccine candidates from C. perfringens. The methodology involves:

  • Genomic comparison of multiple C. perfringens strains (both pathogenic and commensal) to identify proteins unique to pathogenic strains

  • In silico prediction of surface exposure and immunogenicity

  • PCR validation to confirm the presence of candidate genes in pathogenic strains and their absence in commensal strains

  • Sequence alignment to verify uniqueness to pathogenic strains

Using this approach, researchers identified fourteen proteins unique to necrotic enteritis-causing C. perfringens strains. After validation, seven candidates were confirmed to be exclusive to pathogenic strains, with five successfully cloned and expressed as recombinant proteins (P153, P264-2, P509, P537, P561) .

This systematic approach allows researchers to focus experimental efforts on proteins with the highest probability of success as vaccine candidates.

How do fusion tags affect the immunogenicity of recombinant C. perfringens proteins?

Fusion tags can significantly impact both the expression and immunogenicity of recombinant C. perfringens proteins. Research with CPB derivatives has demonstrated that:

  • SUMO-tagged CPB variant (rSUMO-CPBm4) induced substantially higher neutralizing antibody titers compared to the non-tagged version (rCPBm4) when used as a vaccine antigen .

  • The enhanced immunogenicity correlates with improved protein stability and solubility conferred by the SUMO tag .

  • The beneficial effect of the SUMO tag persisted even after two immunizations, with rSUMO-CPBm4 generating at least 8-fold higher neutralizing antibody titers than the threshold established in the Veterinary Pharmacopoeia for CPB .

This evidence suggests that the selection of an appropriate fusion tag should be considered not just for improving protein expression and purification, but also as a strategy to enhance vaccine efficacy through improved immunogenicity.

What is the optimal protocol for evaluating toxin-neutralizing antibody responses against C. perfringens proteins?

The evaluation of toxin-neutralizing antibody (TNA) responses is critical for assessing the protective potential of vaccines against C. perfringens toxins. Based on research with CPB derivatives, the following methodology is recommended:

  • Collect serum samples from immunized animals (e.g., rabbits receiving two doses of 100 μg recombinant protein with an oil-based adjuvant like Montanide ISA 201 at a 21-day interval) .

  • Prepare the challenge material: For CPB, this typically involves anaerobic culture of C. perfringens type C strains, followed by centrifugation, filtration, and storage of the supernatant containing crude toxin .

  • Determine the minimal lethal dose (MLD) of the crude toxin preparation by injecting different concentrations into test animals and identifying the dose causing mortality .

  • For neutralization assays, mix serum dilutions with a standardized amount of crude toxin and assess protection using in vivo or in vitro methods .

  • Calculate the neutralizing antibody titer as the highest dilution providing protection against toxin effects .

This approach allows for quantitative comparison of the protective potential of different vaccine formulations and has been successfully used to demonstrate the superior immunogenicity of rSUMO-CPBm4 compared to non-tagged rCPBm4 .

What immunization protocols are most effective for evaluating recombinant C. perfringens proteins as vaccine candidates?

Based on successful studies with CPB derivatives and surface proteins, the following immunization protocol has proven effective:

  • Animal selection: Rabbits are commonly used for initial immunogenicity studies, while the target species (e.g., chickens for poultry vaccines) should be included in later-stage evaluations .

  • Dose and schedule:

    • Administer 100 μg of recombinant protein per immunization

    • Use a prime-boost protocol with two doses separated by 21 days

    • Emulsify the protein with an oil-based adjuvant (e.g., Montanide ISA 201) in a 1:1 (v/v) ratio

  • Control groups: Include animals receiving adjuvant only (e.g., PBS emulsified with adjuvant) as negative controls .

  • Sampling timeline:

    • Collect pre-immune serum before first immunization

    • Collect final serum samples 2-3 weeks after the second immunization

    • For more detailed kinetic analysis, additional samples can be collected at intermediate timepoints

This protocol has successfully demonstrated the immunogenicity of various C. perfringens proteins, including the ability of rSUMO-CPBm4 to induce protective antibody responses against CPB .

What criteria should be used to select candidate proteins for recombinant expression from C. perfringens?

When selecting candidate proteins from C. perfringens for recombinant expression and evaluation as vaccine antigens, consider the following criteria:

  • Association with virulence: Target proteins unique to pathogenic strains or directly involved in pathogenesis. The CSRV approach identified proteins present exclusively in necrotic enteritis-causing strains and absent from commensal strains .

  • Surface exposure: Prioritize proteins predicted to be surface-exposed, as these are more accessible to the immune system. Surface proteins like P509, predicted as a prepilin N-terminal cleavage methylation domain protein, have shown good immunogenicity .

  • Sequence conservation: Analyze sequence conservation among pathogenic strains to ensure broad coverage. PCR validation across multiple strains can confirm conservation .

  • Exclusivity: Verify that candidate proteins are absent from commensal strains to avoid disrupting beneficial microbiota. Proteins showing 97-99% sequence homology with commensal strains should be excluded .

  • Amenability to expression: Consider factors affecting recombinant expression, such as size, hydrophobicity, and presence of challenging features like multiple disulfide bonds .

Applying these criteria systematically can help focus experimental efforts on the most promising candidates, increasing the likelihood of identifying effective vaccine antigens.

What methods are most effective for confirming the identity and antigenicity of purified recombinant C. perfringens proteins?

Multiple complementary methods should be employed to comprehensively characterize recombinant C. perfringens proteins:

  • SDS-PAGE analysis: Assess purity and confirm expected molecular weight. For rCPBm4 and rSUMO-CPBm4, bands at approximately 36 kDa and 52 kDa respectively were observed, consistent with their predicted sizes .

  • Western blot analysis using:

    • Anti-His antibodies to confirm the presence of the His-tag

    • Polyclonal antibodies against native C. perfringens proteins to verify antigenicity

  • DNA sequencing: Verify the construct sequence to confirm correct protein coding sequence and introduced mutations .

  • BLAST alignment: Compare the sequence with reference databases to confirm identity and detect any unintended variations .

  • Functional assays: For modified toxins, confirm lack of toxicity through in vivo testing. Neither rCPBm4 nor rSUMO-CPBm4 showed toxicity in mice even at high doses (6,250 μg/kg) .

This multi-faceted approach ensures that the recombinant protein maintains the expected structural and antigenic properties while confirming the success of any intended modifications.

How can the solubility of recombinant C. perfringens proteins be systematically analyzed?

Systematic analysis of protein solubility is essential for optimizing expression conditions. Based on studies with CPB derivatives, the following approach is recommended:

  • Expression testing under multiple conditions:

    • Test different induction temperatures (e.g., 37°C vs. 15°C)

    • Vary induction times (e.g., 4 hrs vs. 16 hrs)

    • Compare different expression constructs (e.g., tagged vs. untagged proteins)

  • Quantitative analysis:

    • Separate soluble and insoluble fractions by centrifugation after cell lysis

    • Analyze both fractions by SDS-PAGE

    • Calculate the percentage of soluble protein using densitometry

  • Tabular data representation:

Protein ConstructInduction ConditionTotal Expression (mg/mL)Soluble Fraction (%)
rCPBm437°C, 4 hrsVariableMinimal
rCPBm415°C, 16 hrsVariableMinimal
rSUMO-CPBm437°C, 4 hrsVariable<5%
rSUMO-CPBm415°C, 16 hrs56 mg/mL17%

This systematic approach revealed that the SUMO-tagged CPB variant (rSUMO-CPBm4) showed significantly improved solubility (17%) when induced at 15°C for 16 hrs, while the untagged version remained primarily insoluble under all tested conditions .

What strategies can address cloning difficulties with C. perfringens genes?

Cloning C. perfringens genes can present various challenges. Based on experiences reported in research with surface proteins, consider these approaches:

  • Vector selection: If attempts with one vector system fail, try alternative vectors. For example, cloning of the P509 gene was unsuccessful in pET151/D-TOPO® but succeeded in pET-24a(+) .

  • Codon optimization: Optimize codons according to the expression host's preferences. This approach was successfully used for CPB derivatives, with genes optimized for E. coli expression .

  • Synthetic gene synthesis: For persistently problematic genes, commercial gene synthesis can be an effective solution. This approach was successfully used for the P509 gene .

  • Sequence verification: Always verify cloned constructs by DNA sequencing to ensure fidelity .

  • Expression vector design: Consider using vectors with tighter control of basal expression if the target protein might be toxic to the host .

These strategies can overcome common obstacles in cloning C. perfringens genes, as demonstrated in the successful expression of multiple surface proteins and CPB derivatives .

How can in vivo protection studies be designed to evaluate recombinant C. perfringens proteins as vaccine candidates?

Well-designed protection studies are crucial for evaluating vaccine efficacy. Based on successful studies with CPB derivatives, consider the following design elements:

  • Immunization protocol:

    • Use the optimized immunization protocol described earlier (two doses of 100 μg protein with Montanide ISA 201 adjuvant, 21 days apart)

    • Include appropriate control groups (adjuvant only)

  • Challenge material:

    • For toxin studies, use standardized preparations of crude toxin

    • Determine the minimal lethal dose (MLD) in preliminary studies

    • Ensure consistent challenge material across all experimental groups

  • Challenge protocol:

    • Challenge immunized animals 2-3 weeks after the final immunization

    • Use a challenge dose sufficient to cause clear effects in control animals

    • Monitor animals for appropriate endpoints (survival, clinical signs)

  • Data analysis:

    • Compare survival rates between vaccinated and control groups

    • Correlate protection with antibody titers to identify potential correlates of protection

    • Perform statistical analysis to determine significance of observed differences

This approach successfully demonstrated that rabbits immunized with rSUMO-CPBm4 were protected when challenged with crude CPB, while the untagged version provided less consistent protection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.