Recombinant Clostridium perfringens Putative AgrB-like protein (CPR_1532)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
CPR_1532; Putative AgrB-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Clostridium perfringens (strain SM101 / Type A)
Target Names
CPR_1532
Target Protein Sequence
MIENLSKLISEKVSSELNYDNERKEIIQYGTYALIQTLISIISVFIIGLLFNIALEALIF LFTASILRKYSGGAHSESSNVCTLLGIIISICIGFLVKSSFFTKMNFEIIVFIGIVIFVF GYFIVFKFAPVDTKNKPIKTEKKKKRMKKGSLKILTIYLFIEILSIILYYNLGWSLVKSV MLSIILGVAWQCITLTYIGNILLKTIDSFTNKLL
Uniprot No.

Target Background

Function
This protein might play a role in the proteolytic processing of a quorum sensing system signal molecule precursor.
Database Links

KEGG: cpr:CPR_1532

Protein Families
AgrB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Clostridium perfringens Putative AgrB-like protein (CPR_1532)?

Recombinant Clostridium perfringens CPR_1532 is a putative AgrB-like protein (amino acids 1-214) derived from the Clostridium perfringens strain SM101/Type A. It belongs to a class of proteins typically involved in bacterial quorum sensing and virulence regulation. The protein can be expressed recombinantly in various expression systems including E. coli, yeast, baculovirus, or mammalian cell lines for research applications . It is important to note that Clostridium perfringens is a Gram-positive, spore-forming anaerobic bacterium that plays substantial roles in non-foodborne human, animal, and avian diseases as well as human foodborne disease .

How does CPR_1532 relate to other characterized proteins in C. perfringens?

CPR_1532 is one of many proteins encoded in the C. perfringens genome that may be involved in cellular functions such as cell growth, division, or pathogenicity. While the precise function of CPR_1532 isn't fully characterized in the provided literature, C. perfringens is known to express various functional proteins including autolysis proteins involved with cell growth and division as well as germination of spores . Other characterized proteins from C. perfringens include germination-related enzymes (CspA, CspB, CspC, SleC, and SleM), peptidoglycan hydrolases with N-acetylglucosaminidase activity (Acp), and extracellular initiation proteins involved in spore germination .

What are the structural features of CPR_1532?

While specific structural data for CPR_1532 is not provided in the search results, advances in protein structure prediction using tools like AlphaFold have revolutionized our ability to determine protein structures with high accuracy. Based on methodologies applied to similar proteins, we can predict that CPR_1532 likely possesses a unique tertiary structure that enables its putative AgrB-like function . Modern structure prediction tools have demonstrated high accuracy in predicting 3D structures of bacterial proteins, with metrics such as TM-scores (measuring global structural similarity) and relative Z-errors (measuring relative structural differences) being used to validate prediction quality .

What are the recommended expression systems for recombinant CPR_1532 production?

Recombinant CPR_1532 protein can be expressed using several expression systems:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, rapid growth, cost-effectiveMay require optimization for proper folding
YeastPost-translational modifications, proper foldingLonger production time compared to E. coli
BaculovirusComplex protein folding, post-translational modificationsMore resource-intensive setup
Mammalian CellMost native-like modifications, complex foldingHighest cost, lower yield

The choice depends on downstream applications and specific requirements for protein structure and function. The primary source information indicates that all these systems have been used successfully for recombinant CPR_1532 expression .

How can researchers clone and express the CPR_1532 gene from C. perfringens genomic DNA?

Researchers can use the following methodological approach:

  • Design primers with appropriate restriction sites. For example, using a similar approach to that described for other C. perfringens proteins: forward primer with an NdeI restriction site and reverse primer with an XhoI restriction site .

  • Extract genomic DNA from C. perfringens using established protocols for Gram-positive bacteria .

  • Amplify the target gene using PCR with high-fidelity polymerase.

  • Digest both the PCR products and expression vector (e.g., pET21a) with appropriate restriction enzymes (NdeI and XhoI) .

  • Ligate the digested insert into the expression vector and transform into an appropriate E. coli strain (initial transformation into DH5α for plasmid preparation, followed by transformation into an expression strain like Rosetta 2(DE3)) .

  • Induce protein expression and purify using affinity chromatography, taking advantage of tags such as the 6x-histidine tag encoded by vectors like pET21a .

This approach has been successfully applied to other C. perfringens proteins and can be adapted for CPR_1532 .

How can structural prediction tools like AlphaFold be applied to study CPR_1532?

AlphaFold and similar deep learning-based protein structure prediction tools can be applied to CPR_1532 research in several ways:

  • Structure prediction: Generate highly accurate 3D structure models of CPR_1532 without the need for experimental structure determination. This is particularly valuable as structural studies have shown that AlphaFold predictions achieve high accuracy, with TM-scores (measuring global structural similarity) often above 0.89 and relative Z-errors below 0.22 for bacterial proteins .

  • Functional annotation: Predicted structures can be compared against structural databases to identify structural homologs that might provide insights into CPR_1532's function. As demonstrated with Anti-CRISPR proteins, structural prediction can reveal unexpected functional relationships not apparent from sequence analysis alone .

  • Structure-based experimental design: The predicted structure can guide the design of site-directed mutagenesis experiments to investigate specific functional residues or domains within CPR_1532.

  • Protein-protein interaction studies: Structural models can facilitate prediction of potential interaction partners and interfaces, which can subsequently be validated experimentally .

  • Evolutionary analysis: Structure-based phylogenetic trees can provide insights into evolutionary relationships that might not be apparent from sequence-based analyses. This approach has revealed that proteins with similar functions often cluster together on structural trees despite sequence divergence .

What is known about the potential role of CPR_1532 in bacterial virulence and pathogenicity?

While direct evidence for CPR_1532's role in virulence is not specified in the search results, as a putative AgrB-like protein, it likely participates in quorum sensing and virulence regulation pathways. In many pathogenic bacteria, AgrB proteins are involved in processing quorum sensing signal molecules that regulate the expression of virulence factors.

C. perfringens is known to cause various diseases through toxin production and is classified into five types (A, B, C, D, or E) based on toxin profiles . It causes food poisoning, gas gangrene, enteritis necroticans, and non-foodborne gastrointestinal infections in humans, as well as enteric diseases in animals .

Research approaches to investigate CPR_1532's role in virulence could include:

  • Gene knockout studies to observe phenotypic changes in virulence

  • Transcriptomic analysis to identify genes co-regulated with CPR_1532

  • In vivo infection models to assess the impact of CPR_1532 deletion or overexpression

  • Protein-protein interaction studies to identify binding partners in virulence pathways

How does CPR_1532 compare to similar proteins in other Clostridium species?

A comprehensive comparative analysis would involve:

  • Sequence comparisons: Multiple sequence alignments of CPR_1532 with homologs from different Clostridium species to identify conserved domains and species-specific variations.

  • Structural comparisons: Using tools like AlphaFold to predict structures of homologs and comparing them using metrics such as TM-score and relative Z-error . The structural tree reconstruction approach described for Anti-CRISPR proteins could be adapted to analyze relationships between AgrB-like proteins across Clostridium species .

  • Functional comparisons: Experimental validation of functional conservation or divergence across species.

  • Genomic context analysis: Examining the genomic neighborhood of CPR_1532 homologs across species to identify conservation or differences in gene clusters.

Such comparisons could reveal evolutionary patterns and functional adaptations specific to C. perfringens pathogenicity.

How can CPR_1532 be used in vaccine development research?

CPR_1532 could potentially be utilized in vaccine development through several approaches:

  • Subunit vaccine candidate: As a recombinant protein, CPR_1532 could be evaluated as a potential antigen for stimulating protective immunity against C. perfringens infections .

  • Adjuvant development: The protein could be studied for potential immunomodulatory properties that might enhance vaccine efficacy.

  • Epitope mapping: Structural predictions combined with immunological assays could identify specific epitopes within CPR_1532 that elicit strong immune responses, which could be incorporated into epitope-based vaccines.

  • Vector-based vaccines: The CPR_1532 gene could be incorporated into viral or bacterial vectors for in vivo expression and immune stimulation.

It is critical to note that while recombinant CPR_1532 protein is available for research applications in vaccine development, these proteins CANNOT be used directly on humans or animals without proper safety testing and regulatory approval .

What analytical techniques are most effective for studying CPR_1532 interactions with host proteins?

Several analytical techniques can be employed to study CPR_1532 interactions with host proteins:

TechniqueApplicationAdvantages
Pull-down assaysIdentify direct protein-protein interactionsCan capture both strong and weak interactions
Yeast two-hybridScreen for potential interaction partnersHigh-throughput capability
Surface Plasmon Resonance (SPR)Measure binding kinetics and affinityReal-time, label-free detection
Isothermal Titration Calorimetry (ITC)Determine thermodynamic parameters of bindingProvides complete thermodynamic profile
Cross-linking mass spectrometryMap interaction interfacesProvides residue-level resolution of binding sites
AlphaFold-MultimerPredict protein complex structuresComputational approach to guide experimental design

For AgrB-like proteins, examining interactions with potential signaling peptides and regulatory proteins would be particularly relevant to understand their role in quorum sensing and virulence regulation.

What are common challenges in expressing soluble CPR_1532, and how can they be addressed?

Common challenges and solutions include:

  • Protein insolubility:

    • Solution: Optimize expression conditions (temperature, induction time, inducer concentration)

    • Alternative: Express with solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Advanced approach: Employ in silico analysis to identify and modify aggregation-prone regions

  • Improper folding:

    • Solution: Co-express with molecular chaperones

    • Alternative: Use slower expression rates at lower temperatures (16-20°C)

    • Advanced approach: Consider expression in eukaryotic systems for complex proteins

  • Toxicity to expression host:

    • Solution: Use tightly controlled expression systems

    • Alternative: Express in specialized strains designed for toxic proteins

    • Advanced approach: Express as separate domains if full-length protein is toxic

  • Low yield:

    • Solution: Optimize codon usage for expression host

    • Alternative: Scale-up culture volumes and optimize media composition

    • Advanced approach: Develop a fed-batch cultivation strategy

How can researchers validate the functional activity of recombinant CPR_1532?

Functional validation approaches could include:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Thermal shift assays to assess protein stability

    • Size exclusion chromatography to confirm monomeric/oligomeric state

  • Biochemical activity assays:

    • For AgrB-like proteins, assess peptide processing activity using synthetic substrates

    • Measure proteolytic activity using fluorogenic peptide substrates

    • Assess membrane integration using liposome association assays

  • Cellular assays:

    • Complementation studies in AgrB-deficient strains

    • Evaluation of quorum sensing restoration in reporter strains

    • Assessment of virulence factor expression modulation

  • Comparative analysis:

    • Compare activity with native protein purified from C. perfringens

    • Benchmark against well-characterized AgrB proteins from other species

How might structural characterization of CPR_1532 contribute to antimicrobial development?

Structural characterization of CPR_1532 could significantly contribute to antimicrobial development in several ways:

  • Structure-based drug design: Detailed structural information can enable the rational design of small molecule inhibitors targeting specific functional domains or active sites of CPR_1532. This approach has proven successful for developing inhibitors against other bacterial virulence factors .

  • Peptide mimetics: If CPR_1532 interacts with specific peptides in its AgrB-like function, structural data could guide the development of peptide mimetics that competitively inhibit its normal function.

  • Allosteric inhibitors: Structural analysis might reveal allosteric sites that could be targeted to modulate protein function indirectly.

  • Cross-species applications: Structural conservation analysis across different pathogenic Clostridium species could identify common features for broad-spectrum antimicrobial development .

  • Alternative antimicrobial approaches: Similar to the use of C. perfringens bacteriophage lytic enzymes and genome-encoded putative N-acetylmuramoyl–l-alanine amidase as potential antimicrobials, structural insights into CPR_1532 could reveal novel antimicrobial strategies .

The development of narrow-spectrum antimicrobials that selectively target pathogenic organisms while avoiding killing beneficial organisms represents an important research direction, particularly given concerns over antimicrobial resistance .

What computational approaches can be used to predict potential functions of CPR_1532 beyond sequence homology?

Advanced computational approaches for functional prediction include:

  • Structure-based function prediction: Using predicted 3D structures from AlphaFold to identify structural similarity with proteins of known function, even when sequence similarity is low. This approach has revealed unexpected functional relationships for proteins like Anti-CRISPR proteins .

  • Protein-protein interaction networks: Integrating predicted interactions based on structural docking with existing protein interaction databases to place CPR_1532 in functional networks.

  • Genomic context analysis: Examining neighboring genes and conserved gene clusters across multiple species to infer functional associations based on genomic proximity.

  • Evolutionary coupling analysis: Identifying co-evolving residues within CPR_1532 or between CPR_1532 and potential partner proteins to predict functional sites and interactions.

  • Molecular dynamics simulations: Using the predicted structure to simulate dynamic behavior and identify potential binding sites or conformational changes relevant to function.

  • Deep learning approaches: Applying neural networks trained on diverse protein function data to predict functional properties from sequence and structural features.

These computational predictions would need experimental validation, but they can significantly narrow the experimental search space and guide hypothesis formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.