Recombinant Clostridium perfringens UPF0060 membrane protein CPR_1507 (CPR_1507)

What is CPR_1507 and what are its fundamental characteristics?

CPR_1507 is a UPF0060 membrane protein from Clostridium perfringens with UniProt ID Q0SST2. It is a relatively small protein consisting of 111 amino acids with a predicted membrane-spanning topology. The complete amino acid sequence is: MENIKSIFYFLLAGVFEIGGGYLIWLWLRQGKSLIYGIIGALVLILYGIIPTLQPENSNFGRVYATYGGIFIVLSILCGWKVDNIIPDKFDLIGGFIALIGVLIIMYAPRG . This protein belongs to the UPF0060 family, which represents uncharacterized protein families with limited functional annotation, making it an interesting target for fundamental research. The protein's small size and defined sequence make it a manageable model for membrane protein studies.

How should CPR_1507 be stored and handled to maintain stability?

For optimal stability, recombinant CPR_1507 should be stored as a lyophilized powder at -20°C/-80°C upon receipt. After reconstitution, working aliquots can be stored at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to prevent protein degradation. For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquoting before storing at -20°C/-80°C significantly enhances stability . The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein integrity during storage .

What expression systems are most effective for recombinant CPR_1507 production?

E. coli has been demonstrated as an effective expression system for CPR_1507 . The His-tagged version of the full-length protein (amino acids 1-111) has been successfully expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE . When designing expression strategies for membrane proteins like CPR_1507, researchers should consider:

• Expression strain selection: BL21(DE3) or C41/C43 strains often work well for membrane proteins

• Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations may improve proper folding

• Membrane extraction methods: Detergent selection is critical for maintaining protein structure and function

For membrane proteins like CPR_1507, alternative expression approaches such as cell-free systems might be considered if traditional systems yield poor results or improperly folded protein.

What methodologies are recommended for structural characterization of CPR_1507?

Structural characterization of membrane proteins like CPR_1507 requires specialized approaches. Recent advancements in CryoEM have revolutionized membrane protein structural biology. For CPR_1507 analysis, consider the following methodological approach:

• Direct membrane extraction: Cycloalkane-modified amphiphilic polymers (CyclAPols) enable direct extraction of membrane proteins without prior detergent solubilization, which can be advantageous for preserving native protein states . This approach has been successfully used to achieve high-resolution structures (3.2 Å) of membrane proteins directly extracted from E. coli membranes .

• Sample preparation for CryoEM: After extraction with CyclAPols, the protein should be purified using affinity chromatography (utilizing the His-tag) . Grid preparation requires optimization of protein concentration (typically 0.5-5 mg/mL), buffer conditions, and vitrification parameters.

• Data collection and processing: High-resolution CryoEM typically requires collection of thousands of micrographs followed by sophisticated image processing using software packages such as RELION, cryoSPARC, or EMAN2.

Although X-ray crystallography has traditionally been used for membrane protein structure determination, the challenges in obtaining well-diffracting crystals make CryoEM an attractive alternative for proteins like CPR_1507.

How might computational approaches enhance structural understanding of CPR_1507?

Recent advances in computational biology offer powerful approaches for studying membrane proteins like CPR_1507:

• Deep learning for structure prediction: Deep learning pipelines have been developed to design complex folds and soluble analogues of integral membrane proteins . These computational approaches can predict structures with remarkable accuracy, as validated by experimental structures.

• Design of soluble analogues: Unique membrane topologies can be recapitulated in solution using computational design approaches . For CPR_1507, this could involve designing a soluble version that maintains key structural features but doesn't require detergents or amphipols for stability.

• Functional enhancement: Computational approaches can be used to engineer native structural motifs into soluble protein analogues, potentially enabling new functional capabilities . This could allow for easier characterization of CPR_1507 function without the challenges associated with membrane proteins.

These computational approaches could significantly accelerate research on CPR_1507 by providing structural models and soluble versions that are more amenable to high-throughput functional studies.

What are the considerations for functional characterization of CPR_1507?

Given the limited functional annotation of UPF0060 family proteins, systematic approaches to functional characterization are essential. Consider the following methodological strategies:

• Bioinformatic analysis: Sequence comparison with functionally annotated proteins, genomic context analysis, and identification of conserved domains can provide initial functional insights.

• Protein-protein interaction studies: Techniques like pull-downs, cross-linking mass spectrometry, or yeast two-hybrid screening can identify interaction partners, potentially revealing functional pathways involving CPR_1507.

• Lipid interaction analysis: As a membrane protein, CPR_1507 likely interacts with specific lipids. Techniques like native mass spectrometry or lipid binding assays can characterize these interactions.

• Functional reconstitution: Incorporating purified CPR_1507 into liposomes or nanodiscs followed by functional assays (e.g., ion flux, substrate transport) can help elucidate its biochemical role.

When designing functional studies, researchers should consider the native membrane environment of CPR_1507 in Clostridium perfringens and attempt to recreate key aspects of this environment in experimental systems.

What purification strategies yield optimal results for CPR_1507?

Purification of membrane proteins like CPR_1507 requires careful consideration of detergents and chromatography techniques. A recommended purification strategy involves:

• Membrane preparation: Harvest E. coli cells expressing His-tagged CPR_1507, resuspend in buffer with protease inhibitors, and disrupt by sonication or French press. Isolate membranes by ultracentrifugation.

• Membrane protein extraction: Two approaches can be considered:

  • Traditional approach: Solubilize membranes with detergents like DDM, LMNG, or FC-12.

  • Direct extraction: Use CyclAPols for direct extraction from membranes without detergent pre-solubilization .

• Affinity chromatography: Purify His-tagged CPR_1507 using Ni-NTA or TALON resin. Include imidazole in wash buffers to reduce non-specific binding.

• Size exclusion chromatography: Further purify protein by size exclusion chromatography to remove aggregates and obtain monodisperse protein.

For quality control, analyze the purified protein by SDS-PAGE (expected >90% purity) and assess structural integrity using circular dichroism or thermal shift assays.

How can recombinant CPR_1507 be adapted for immunological studies?

While no specific immunological data exists for CPR_1507, methodological approaches used for other bacterial membrane proteins can be applied:

• Epitope prediction: Computational tools can identify potential epitopes in CPR_1507 with high affinity for human HLA alleles, similar to approaches used for A. baumannii membrane proteins . This involves analyzing the amino acid sequence for immunodominant regions.

• Recombinant multi-epitope protein design: Selected epitopes can be combined into a recombinant multi-epitope protein (rMEP) designed to elicit strong immune responses . This approach has been successful for other bacterial membrane proteins.

• Functional validation: After expression and purification, circular dichroism can confirm proper secondary structure and protein folding . Interaction with antibodies in sera can validate the immunogenic potential.

This approach could be valuable for developing diagnostic tools or vaccine candidates targeting Clostridium perfringens infections.

What are common challenges in working with CPR_1507 and how can they be addressed?

Membrane proteins like CPR_1507 present several experimental challenges:

When troubleshooting, systematically vary one parameter at a time and maintain careful records of conditions and outcomes to identify optimal protocols.

How should structural data for CPR_1507 be interpreted in the context of membrane protein biology?

When analyzing structural data for CPR_1507, consider these methodological approaches:

• Membrane topology analysis: Identify transmembrane regions and compare with topology predictions. For CPR_1507, the amino acid sequence (MENIKSIFYFLLAGVFEIGGGYLIWLWLRQGKSLIYGIIGALVLILYGIIPTLQPENSNFGRVYATYGGIFIVLSILCGWKVDNIIPDKFDLIGGFIALIGVLIIMYAPRG) suggests multiple hydrophobic segments that likely form transmembrane helices.

• Structural comparison: Compare CPR_1507 structure with other UPF0060 family members or functionally related membrane proteins using tools like DALI or PDBeFold.

• Lipid-protein interactions: Analyze the membrane-facing surfaces for lipid binding pockets or specific lipid interaction sites, which may provide functional insights.

• Evolutionary conservation: Map sequence conservation onto the structure to identify functionally important regions that have been preserved through evolution.

For CryoEM data specifically, assess local resolution variations, which can provide insights into dynamic regions of the protein, and evaluate density quality in the transmembrane region where detergent or amphipol may influence map quality.

How might soluble analogues of CPR_1507 advance research and applications?

Creating soluble analogues of membrane proteins like CPR_1507 using computational design approaches represents a promising research direction:

• Experimental advantages: Soluble protein analogues are easier to express, purify, and crystallize than membrane proteins, potentially accelerating structural and functional studies of CPR_1507 .

• Drug discovery applications: Soluble analogues functionalized with native structural motifs from membrane proteins can enable new approaches in drug discovery . For CPR_1507, this could involve creating a soluble protein that presents key functional elements in a form amenable to high-throughput screening.

• Functional expansion: The creation of soluble proteins with membrane protein functionalities represents a de facto expansion of the functional soluble fold space . This could lead to novel proteins with hybrid properties combining aspects of CPR_1507 with soluble protein characteristics.

The development of robust deep learning pipelines for designing complex folds has enabled the creation of soluble analogues with high experimental success rates , making this approach increasingly feasible for proteins like CPR_1507.

What integrative approaches might yield the most comprehensive understanding of CPR_1507?

A multi-faceted research approach would provide the most comprehensive understanding of CPR_1507:

• Structural biology integration: Combining CryoEM, X-ray crystallography (if possible), NMR spectroscopy of specific domains, and computational prediction can provide complementary structural insights at different resolutions.

• Functional genomics: Genome-wide studies in Clostridium perfringens using techniques like CRISPR interference or transposon mutagenesis can help place CPR_1507 in its proper biological context.

• Membrane biophysics: Techniques like solid-state NMR, neutron reflectometry, or molecular dynamics simulations can characterize CPR_1507's interaction with the membrane environment.

• Comparative biology: Studying homologous proteins across different bacterial species can reveal evolutionary adaptations and conserved functions of UPF0060 family proteins.

Integration of these diverse approaches, combined with computational modeling and prediction, would provide a systems-level understanding of CPR_1507's structure, function, and biological significance.