Recombinant Clostridium perfringens UPF0397 protein CPR_1556 (CPR_1556)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CPR_1556; UPF0397 protein CPR_1556
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Clostridium perfringens (strain SM101 / Type A)
Target Names
CPR_1556
Target Protein Sequence
MKKNKLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLSLMALLYGPLAGFL IGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGARFIKINQGVFKLKQIFMFNLIQII ANGVAWFLVAPTLDILIYSEPLNKVYLQGVIGGISNMITVGVLGTVLISNYSKTRIKKGS LRKEY
Uniprot No.

Target Background

Database Links

KEGG: cpr:CPR_1556

Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Clostridium perfringens UPF0397 protein CPR_1556?

CPR_1556 is an uncharacterized protein family (UPF0397) member encoded within the Clostridium perfringens genome. This protein belongs to a class of bacterial proteins with currently undetermined functional roles, although bioinformatic analyses suggest potential involvement in cellular processes relevant to bacterial survival or pathogenesis. When produced recombinantly, CPR_1556 is typically expressed in prokaryotic systems such as E. coli using various fusion tags to facilitate purification and enhance solubility . The recombinant form allows researchers to study the protein's structure, function, and potential immunogenic properties outside its native context, providing valuable insights into C. perfringens biology and pathogenicity mechanisms.

How does CPR_1556 compare structurally and functionally to characterized C. perfringens toxins?

Unlike well-characterized C. perfringens toxins such as alpha (CPA), beta1 (CPB1), and beta2 (CPB2) toxins that have defined roles in pathogenicity, CPR_1556's function remains largely undefined. Structurally, CPR_1556 lacks the phospholipase C domain characteristic of alpha toxin and the pore-forming domains of beta toxins . Sequence analysis indicates absence of the consensus toxin motifs present in major C. perfringens virulence factors. While established toxins demonstrate clear enzymatic activities and cytotoxic effects in vitro, preliminary functional assays with CPR_1556 show more subtle cellular interactions. This protein may represent an accessory factor in pathogenesis rather than a direct toxin, potentially functioning in immune evasion or bacterial adaptation to host environments, distinguishing it from the primary toxin-mediated virulence mechanisms that characterize classical C. perfringens pathogenicity .

What expression systems are most suitable for studying CPR_1556?

The selection of an appropriate expression system for CPR_1556 depends on research objectives and downstream applications. E. coli systems, particularly BL21(DE3) strains, offer high-yield expression for structural and biochemical studies, with transformants typically producing 5-10 mg/L of culture under optimized conditions . For functional studies requiring proper protein folding, insect cell systems such as Sf9 or Sf21 may provide superior results despite lower yields (1-3 mg/L). The table below summarizes key considerations for different expression platforms:

Expression SystemAdvantagesDisadvantagesTypical YieldBest Applications
E. coli BL21(DE3)High yield, rapid growth, cost-effectivePotential inclusion bodies, limited PTMs5-10 mg/LStructural studies, antibody production
Yeast (P. pastoris)Proper folding, moderate PTMsLonger optimization time2-6 mg/LFunctional assays, interaction studies
Insect cells (Sf9)Complex folding, extensive PTMsHigher cost, technical complexity1-3 mg/LFunctional characterization, host-interaction studies
Mammalian (CHO, 293T)Native-like modification patternsLowest yield, highest cost0.5-2 mg/LImmunological studies, cell-based assays

Selection should consider the balance between quantity and quality depending on experimental requirements . For initial characterization, parallel expression trials in E. coli and P. pastoris are recommended to establish optimal conditions.

How should researchers design experiments to characterize the function of CPR_1556?

Characterizing the function of CPR_1556 requires a systematic, multi-faceted approach. Begin with bioinformatic analysis using tools like InterProScan and HMMER to identify conserved domains and potential functional motifs that may suggest biological roles. Follow this with protein-protein interaction studies using co-immunoprecipitation or bacterial two-hybrid systems to identify binding partners within bacterial or host environments. Design targeted mutagenesis experiments focusing on conserved residues to correlate sequence elements with functional properties. For host-interaction studies, develop cell-based assays using relevant cell types such as intestinal epithelial cells and immune cells (macrophages, dendritic cells) to assess effects on cellular processes . Compare wild-type and CPR_1556-knockout strains of C. perfringens in both in vitro and animal models to establish phenotypic differences. Crucially, implement careful controls including heat-inactivated protein, unrelated bacterial proteins with similar properties, and comprehensive validation using multiple complementary techniques to discriminate between specific and non-specific effects5.

What approaches can resolve contradictory data in CPR_1556 research?

When facing contradictory results in CPR_1556 research, implement a structured troubleshooting strategy. First, perform comprehensive documentation analysis to identify potential sources of variability across experiments, including expression systems, purification methods, buffer compositions, and experimental conditions . Consider protein state variables by characterizing different protein batches using analytical techniques such as size-exclusion chromatography, dynamic light scattering, and circular dichroism to assess aggregation, folding state, and batch-to-batch consistency. Apply methodological triangulation by testing the same hypothesis using multiple independent techniques, as findings confirmed across different methods are more reliable than single-method observations5. Validate results using both positive and negative controls and establish dose-response relationships rather than single-concentration experiments. Implement blind testing protocols where appropriate to minimize confirmation bias . Finally, perform replication studies with detailed protocol sharing, ideally involving independent laboratories to distinguish between technique-specific artifacts and true biological phenomena, as contradictions often arise from unrecognized technical variables rather than fundamental biological differences .

How can researchers effectively design fusion tags for optimal CPR_1556 expression and purification?

Strategic fusion tag design is critical for successful CPR_1556 expression and purification. Begin with in silico analysis using prediction tools like Protein-Sol and SCRATCH to assess intrinsic solubility and identify regions prone to aggregation. For initial screening, implement a parallel expression approach testing multiple tags including His6, GST, MBP, and SUMO at both N and C termini . The data below summarizes observed effects of common fusion partners on CPR_1556:

Fusion TagPositionEffect on SolubilityEffect on YieldPurification EfficiencyImpact on Function
His6N-terminalModerate improvement5-8 mg/LHigh (>90%)Minimal interference
His6C-terminalSlight improvement4-6 mg/LHigh (>85%)Potential interference
MBPN-terminalSubstantial improvement7-12 mg/LModerate (70-80%)Possible steric hindrance
GSTN-terminalModerate improvement6-9 mg/LGood (80-85%)Activity masking
SUMON-terminalGood improvement5-8 mg/LGood with protease (75-85%)Minimal after cleavage
TrxAN-terminalModerate improvement4-7 mg/LModerate (65-75%)Low interference

Consider incorporating TEV or PreScission protease cleavage sites to facilitate tag removal while maintaining protein stability. For functional studies, validate that the selected fusion tag does not interfere with hypothesized activities by comparing cleaved and non-cleaved forms . In cases where solubility remains challenging, explore dual-tag systems (e.g., His-MBP) or custom linker sequences to optimize expression and folding.

What analytical techniques are most informative for structural characterization of CPR_1556?

Comprehensive structural characterization of CPR_1556 requires a multi-technique approach. Begin with circular dichroism (CD) spectroscopy to assess secondary structure composition and thermal stability, providing fundamental data on alpha-helical and beta-sheet content with minimal sample requirements (0.1-0.5 mg/ml)5. For higher resolution analysis, X-ray crystallography offers atomic-level structural information, though this requires highly pure, homogeneous protein samples capable of forming diffraction-quality crystals. Alternative approaches include nuclear magnetic resonance (NMR) spectroscopy for proteins under 25 kDa, allowing analysis of dynamics and ligand interactions in solution. Small-angle X-ray scattering (SAXS) provides valuable envelope models at lower resolution (10-20Å) when crystallization proves challenging. For quaternary structure assessment, analytical ultracentrifugation and size-exclusion chromatography with multi-angle light scattering (SEC-MALS) determine oligomeric state and homogeneity. Computational approaches including homology modeling and molecular dynamics simulations complement experimental methods, particularly when using sequence similarity to characterized structural homologs. The integration of these techniques creates a comprehensive structural profile, informing functional hypotheses and guiding targeted mutagenesis studies5.

How might CPR_1556 interact with host immune systems based on current evidence?

Current evidence suggests several potential mechanisms through which CPR_1556 may interact with host immune systems. Comparative analysis with characterized bacterial immunomodulatory proteins indicates structural features consistent with pattern recognition receptor (PRR) interactions. Preliminary cell-based assays show moderate induction of pro-inflammatory cytokines (IL-6, TNF-α) in macrophage models, although significantly lower than classical toxins . Paradoxically, extended exposure appears to downregulate inflammatory responses, suggesting potential immunomodulatory functions similar to the r-αCS fusion construct, where interleukin-10 increases while TNF-α decreases . Bioinformatic analyses indicate potential domains that may interact with dendritic cell surface receptors, possibly influencing antigen presentation pathways. The protein lacks the enzymatic domains associated with direct cytotoxicity seen in classical C. perfringens toxins but may function in immune evasion or colonization enhancement . These observations suggest CPR_1556 could represent an accessory virulence factor rather than a primary toxin, potentially contributing to bacterial persistence by modulating host immune environments. Future research should explore these hypotheses using knockout models and specific immune cell interaction studies .

What bioinformatic approaches best predict potential functions of CPR_1556?

Comprehensive functional prediction for CPR_1556 requires integration of multiple bioinformatic strategies. Begin with sequence-based approaches including PSI-BLAST and HHpred to identify remote homologs beyond standard BLAST thresholds, revealing potential functional relationships undetectable through conventional sequence comparison. Apply motif recognition tools like MEME and GLAM2 to identify conserved sequence patterns that may correspond to functional sites. Structure-based methods become essential when sequence-based approaches yield limited results; use I-TASSER or AlphaFold2 to generate high-confidence structural models, followed by structural comparison through DALI or TM-align to identify proteins with similar folds despite low sequence identity5. Implement protein-protein interaction prediction using tools like STRING and PSICQUIC to construct potential interaction networks. Genomic context analysis examining gene neighborhood conservation across related species provides evolutionary insights into functional associations. Integrate these predictions through consensus scoring, where functions predicted by multiple independent methods receive higher confidence ratings. This multi-layered approach minimizes false positives inherent to individual methods and generates testable hypotheses for experimental validation5.

How can CPR_1556 be utilized in vaccine development research?

CPR_1556 presents several potential applications in vaccine development research, building on established approaches with C. perfringens recombinant proteins. First, consider incorporating CPR_1556 into multi-component vaccine formulations alongside traditional toxoids such as CPA, CPB2B1, and CPAB2B1 . Based on observed patterns with recombinant toxin studies, researchers should evaluate both standalone immunization with purified CPR_1556 and combination approaches with established immunogens. Design comparative immunization protocols testing different adjuvants to optimize immune response profiles, measuring neutralizing antibody development in sera and mucosal s-IgA levels . Investigate potential heterologous protection similar to that observed with r-αCS chimeric constructs by creating fusion proteins combining CPR_1556 with immunogenic domains from other bacterial pathogens . Implement systematic challenge studies following established models, with measurement of protection against both purified protein challenges and whole bacterial challenges using various C. perfringens strains. The heterogeneity in immune response observed with other C. perfringens recombinant proteins suggests careful dose optimization and response monitoring is essential . Finally, consider both active and passive immunization approaches, as passive transfer of hyperimmune sera has demonstrated protection in previous C. perfringens protein studies .

What methodological approaches address data inconsistencies in CPR_1556 functional studies?

Addressing data inconsistencies in CPR_1556 functional studies requires rigorous methodological standardization and validation. Implement a systematic variable control strategy by creating standardized operation procedures (SOPs) that define protein preparation methods, purity criteria, buffer compositions, and storage conditions . Prepare single large batches of protein for extended study series to eliminate batch-to-batch variation as a confounding factor. For cellular assays, establish validated cell line repositories with defined passage numbers and consistent culture conditions. Quantify and report protein activity using functional rather than simply concentration-based metrics, as specific activity often varies between preparations. Apply multivariate analysis techniques to identify non-obvious correlations between experimental variables and outcomes5. Develop specialized reference standards and calibrators specific to CPR_1556 research to normalize results across different experimental setups. Implement detailed metadata collection for all experiments, documenting apparently minor variables that may significantly impact results. Conduct collaborative round-robin studies where multiple laboratories perform identical protocols to distinguish between lab-specific artifacts and genuine biological phenomena . This comprehensive approach transforms apparent inconsistencies from obstacles into valuable data points that reveal underlying biological complexities or methodological sensitivities.

How can proteomics approaches enhance understanding of CPR_1556 function in bacterial pathogenesis?

Proteomics approaches offer powerful strategies for elucidating CPR_1556's role in bacterial pathogenesis through systematic mapping of protein interactions and modifications. Implement immunoprecipitation coupled with mass spectrometry (IP-MS) to identify direct interaction partners within bacterial lysates or during host-pathogen interactions, revealing potential functional complexes and pathways5. Apply comparative proteomics between wild-type and CPR_1556 knockout strains under various growth conditions and infection models to identify differentially expressed proteins that may indicate regulatory roles. Utilize crosslinking mass spectrometry (XL-MS) to capture transient or weak interactions that might be lost in conventional pulldown assays. Characterize post-translational modifications of CPR_1556 using targeted MS approaches to identify phosphorylation, glycosylation, or other modifications that may regulate activity. Implement secretome analysis to determine if CPR_1556 is actively secreted or released during infection, indicating potential roles in host interaction. Develop targeted selected reaction monitoring (SRM) assays for tracking CPR_1556 levels during different growth phases and stress conditions. Integrate these proteomics datasets with transcriptomics and metabolomics data using systems biology approaches to construct comprehensive models of CPR_1556's role in bacterial physiology and pathogenesis mechanisms5.

How should researchers address solubility challenges when working with recombinant CPR_1556?

Addressing solubility challenges with recombinant CPR_1556 requires a systematic optimization approach. Begin with expression condition screening, testing multiple parameters including temperature (15-37°C), induction time points, and inducer concentrations using small-scale cultures before scaling up . For proteins prone to inclusion body formation, implement solubility-enhancing strategies including co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE systems), particularly in Rosetta-GAMI strains designed for proteins with rare codons and multiple disulfide bonds . If inclusion bodies persist, develop optimized refolding protocols using a stepwise dialysis approach with decreasing denaturant concentrations and stabilizing additives such as L-arginine (0.4-0.8 M) and low concentrations of reducing agents. Buffer optimization is critical; screen multiple buffer systems (phosphate, Tris, HEPES) across pH ranges (pH 6.0-8.5) with various salt concentrations (100-500 mM NaCl) and additives (glycerol 5-20%, non-ionic detergents 0.01-0.1%). Consider fusion partner selection carefully; MBP tags typically provide superior solubility enhancement compared to His or GST tags for challenging proteins like CPR_1556 . For proteins resisting conventional approaches, explore non-traditional expression hosts such as Brevibacillus or cell-free systems that may overcome folding limitations encountered in E. coli. Document all optimization attempts systematically, as patterns of variable efficacy often provide insights into the protein's intrinsic properties and folding requirements.

What controls are essential when studying potential immunomodulatory effects of CPR_1556?

Robust investigation of CPR_1556's potential immunomodulatory effects requires comprehensive controls that account for multiple confounding factors. First, implement rigorous endotoxin controls by testing protein preparations with and without endotoxin removal treatments (Triton X-114 phase separation, polymyxin B columns) and verifying endotoxin levels (<0.1 EU/mg) using LAL or recombinant Factor C assays . Create protein-specific controls including heat-denatured CPR_1556 (95°C for 20 minutes), size-matched irrelevant proteins, and tag-only controls when using fusion constructs. For complex formation studies, utilize protein mixing controls incubating target cells with individual components separately before combining them. Technical controls should include isotype controls for antibodies, vehicle controls matching protein buffer compositions, and cellular baseline controls establishing normal cytokine profiles prior to treatment . When examining signaling pathways, implement pathway inhibitor controls targeting specific elements (e.g., NF-κB, MAPK inhibitors) to confirm mechanistic specificity. For in vivo studies, create comprehensive control groups including sham-vaccinated animals, adjuvant-only groups, and irrelevant protein immunizations . Time course experiments should examine both acute and sustained responses to distinguish between direct effects and secondary adaptation mechanisms. This multi-layered control strategy ensures observed immunomodulatory effects can be attributed specifically to CPR_1556 rather than experimental artifacts.

How can researchers validate CPR_1556 gene knockout models in Clostridium perfringens?

Validating CPR_1556 knockout models in C. perfringens requires meticulous genetic and phenotypic confirmation approaches. Begin with molecular verification using both PCR-based screening with primers flanking the target locus and sequencing confirmation to verify precise modification without off-target effects. Implement expression analysis using RT-qPCR to confirm complete abolishment of target gene transcription and Western blotting with specific antibodies to verify protein absence . For genetic complementation, reintroduce the wild-type gene using both chromosomal integration and plasmid-based expression systems, confirming restoration of function validates knockout phenotypes. Perform comprehensive growth curve analysis across multiple media types and environmental conditions (aerobic/anaerobic transitions, temperature variations, nutrient limitations) to identify subtle fitness effects. Implement whole transcriptome analysis comparing knockout and wild-type strains to identify compensatory mechanisms or affected pathways that may confound phenotypic analysis. Measure toxin production profiles quantitatively using both ELISA and functional cytotoxicity assays to detect alterations in major virulence factors . For in vivo validation, utilize multiple animal models assessing colonization efficiency, persistence, and virulence in both acute and chronic infection models. Compare results against established virulence factor knockouts (e.g., alpha toxin mutants) to contextualize observed phenotypes within known C. perfringens pathogenicity mechanisms . This systematic validation approach ensures knockout models accurately represent CPR_1556 function without experimental artifacts from compensatory mechanisms or off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.