Recombinant Clostridium phytofermentans ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
atpF; Cphy_3740; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) (Clostridium phytofermentans)
Target Names
atpF
Target Protein Sequence
MYSTTVLATGTKDTSLVNRIFGLDMQLVVDVAIMGLAIFVLFLILSYLLFNPARELLQKR QDRIKEEMDSSAKDKKEATQLKTNYEAKIKEASKEVDEILSEGRKKALKRENDIVDEAKV EASRIVDRANKEIELNKSKMKDEVKQEMIAVASVMAGKIIAGNIDETKQKQLIDEALNEM GDETWQN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, housing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the ATP synthase operon structure in Clostridium phytofermentans?

Based on comparative analysis with related clostridia species like C. pasteurianum, the ATP synthase genes in C. phytofermentans are likely organized in an operon consisting of nine genes arranged in the order atpI(i), atpB(a), atpE(c), atpF(b), atpH(δ), atpA(α), atpG(γ), atpD(β), and atpC(ε). This organization is consistent with what has been observed in many other bacterial species. The atpF gene specifically encodes the b subunit of the ATP synthase complex, which forms a critical part of the peripheral stalk connecting the F1 and Fo domains . The positioning of atpF as the fourth gene in the operon is highly conserved across clostridial species, suggesting evolutionary constraints on operon organization due to functional importance of the order of expression or assembly.

What is the structure and function of ATP synthase subunit b in bacterial systems?

The b subunit (atpF gene product) serves as a critical structural component of the peripheral stalk (or stator) of the F1Fo ATP synthase. This peripheral stalk connects the membrane-embedded Fo portion with the catalytic F1 portion. The protein typically has a single transmembrane helix at its N-terminus anchored in the membrane, while the majority of the protein forms an extended right-handed coiled-coil structure that extends from the membrane to the top of F1. In most bacteria, including Clostridium species, two identical b subunits form a homodimeric stator structure . The primary function of subunit b is to prevent rotation of the α3β3 hexamer during catalysis by anchoring it to the membrane, allowing the central stalk (composed of γ, δ, and ε subunits) to rotate within the α3β3 hexamer during ATP synthesis or hydrolysis.

What is known about ATP synthase activity in Clostridium species?

Studies on ATP synthase in the related species C. pasteurianum have shown that the amount of ATPase activity in the membranes is relatively low compared to what has been found in many other bacteria . This lower activity may be related to the fermentative, anaerobic lifestyle of Clostridium species. The F1Fo complexes solubilized from membranes of C. pasteurianum have similar masses to those from E. coli, suggesting similar subunit compositions despite differences in activity levels. Interestingly, the C. pasteurianum ATP synthase showed unique regulatory properties, being activated by thiocyanate, cyanate, or sulfhydryl compounds, while being inhibited by sulfite, bisulfite, or bicarbonate. It also displayed tolerance to inhibition by dicyclohexylcarbodiimide . Whether C. phytofermentans ATP synthase shares these regulatory properties remains to be fully determined, but given evolutionary relationships, similar mechanisms might be expected.

What expression systems are optimal for recombinant production of C. phytofermentans atpF?

Successful expression of C. phytofermentans genes, including those from the ATP operon, requires careful consideration of codon usage, protein folding, and potential toxicity effects. For recombinant expression of C. phytofermentans atpF, several systems can be considered:

  • Homologous expression in C. phytofermentans: This approach would provide the most native environment for proper folding and potential post-translational modifications. Based on research with C. phytofermentans, plasmids with specific Gram-positive origins of replication such as pBP1 or pCB102 can be used, along with appropriate selectable markers like ermB (erythromycin resistance), aad9 (spectinomycin resistance), or catP (thiamphenicol resistance) . The following table summarizes key plasmids suitable for expression in C. phytofermentans:

PlasmidGram(+) OriginAntibiotic ResistanceFeatures
pQmod2EpBP1ermBColE1 Gram(-) origin, MCS
pQmod2CpBP1catPColE1 Gram(-) origin, MCS
pQmod2SpBP1aad9ColE1 Gram(-) origin, MCS
pQmod3EpCB102ermBColE1 Gram(-) origin, MCS
pQmod3CpCB102catPColE1 Gram(-) origin, MCS
pQmod3SpCB102aad9ColE1 Gram(-) origin, MCS
  • Heterologous expression in E. coli: While simpler to work with, this approach may face challenges with codon usage differences and proper folding of Clostridium proteins. For membrane proteins like subunit b, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may be necessary. Fusion tags like hexahistidine, MBP, or SUMO can enhance solubility and facilitate purification.

  • Cell-free expression systems: These avoid potential toxicity issues and can be optimized with chaperones and membrane mimetics for proper folding of subunit b.

For regulated expression, the tetracycline-inducible system developed for C. phytofermentans using the PgusA2-tetO2/1 promoter and TetR repressor shows promise, with induction using anhydrotetracycline (aTc) concentrations between 5-200 ng/mL .

How can site-directed mutagenesis be used to study functional domains in the atpF gene product?

Site-directed mutagenesis of the atpF gene can provide valuable insights into structure-function relationships of the b subunit. The following methodological approach is recommended:

  • Target identification: Based on sequence alignments with well-characterized b subunits from other species, identify conserved residues likely critical for function. Key regions include:

    • The N-terminal transmembrane domain (membrane anchoring)

    • The dimerization interface between the two b subunits

    • The δ-subunit interaction region at the C-terminus

  • Mutagenesis strategy: For C. phytofermentans genes, the Golden Gate assembly system using BsaI sites has been successfully employed . Using the pQmod-GG plasmids (such as pQmod2E-GG or pQmod3E-GG) that contain BsaI sites flanking an RFP cassette for red/white selection, mutant versions of atpF can be efficiently generated.

  • Functional analysis: Mutants can be assessed through:

    • Complementation assays in ATP synthase-deficient strains

    • ATP hydrolysis activity measurements

    • Proton pumping assays

    • Protein-protein interaction studies (e.g., with the δ subunit)

  • In vivo studies: Using the inducible expression system (PgusA2-TetO2/1-atpF, miniPthl-tetR), mutant variants can be conditionally expressed in C. phytofermentans to assess dominant-negative effects or complementation capacity.

What approaches can be used to study interactions between subunit b and other ATP synthase components?

Understanding the interaction network of subunit b is crucial for elucidating its role in ATP synthase assembly and function. Several approaches can be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against recombinant subunit b to pull down associated proteins. Western blotting with antibodies against other ATP synthase subunits can confirm interactions. Similar approaches have successfully detected eight subunits (α, β, γ, δ, ε, a, b, and c) in the F1Fo complex from C. pasteurianum .

  • Bacterial two-hybrid systems: Modified for anaerobic expression to investigate direct protein-protein interactions between subunit b and other components.

  • Cross-linking mass spectrometry: Chemical cross-linkers can capture transient interactions, followed by mass spectrometry identification of cross-linked peptides, revealing the spatial organization of subunit b relative to other components.

  • FRET (Förster Resonance Energy Transfer): By tagging subunit b and potential interaction partners with fluorescent proteins, dynamic interactions can be monitored in living cells.

  • Cryo-EM structural analysis: For whole-complex studies to visualize the position and interactions of subunit b within the entire ATP synthase complex.

How does the regulatory response of ATP synthase differ between C. phytofermentans and other bacterial species?

ATP synthase regulation in Clostridium species appears distinct from many other bacteria. In C. pasteurianum, the ATP synthase shows unique regulatory properties:

  • Activators: Thiocyanate, cyanate, and sulfhydryl compounds activate the enzyme, with the F1 portion being the target of thiol activation .

  • Inhibitors: Sulfite, bisulfite, and bicarbonate inhibit activity. Notably, thiocyanate and sulfite exhibit competitive behavior with respect to each other but noncompetitive behavior regarding the substrate Mg-ATP .

  • DCCD resistance: Unlike many bacterial ATP synthases, C. pasteurianum F1Fo showed tolerance to inhibition by dicyclohexylcarbodiimide (DCCD) .

For C. phytofermentans, characterizing these regulatory responses would provide insights into how this organism adapts its energy metabolism to its unique ecological niche as a plant biomass fermenter. Comparative studies between recombinant ATP synthase complexes with native or substituted atpF genes could reveal the role of subunit b in these regulatory differences.

How can the atpF gene be cloned from C. phytofermentans genomic DNA?

The following methodological approach is recommended for cloning the atpF gene:

  • Primer design: Based on the annotated genome sequence of C. phytofermentans (ATCC 700394), design primers that encompass the entire atpF coding sequence with appropriate restriction sites or overhangs for your cloning strategy. Consider adding:

    • 5-10 bp of flanking sequence before restriction sites

    • A 6xHis-tag or other purification tag (N or C-terminal)

    • Optional protease cleavage sites

  • DNA extraction: Extract genomic DNA from C. phytofermentans using anaerobic techniques to maintain cell viability. Commercial kits for Gram-positive bacteria work well, but special attention to the thick peptidoglycan layer is necessary.

  • PCR amplification: Use high-fidelity DNA polymerase (e.g., Q5, Phusion) with optimized conditions for GC-rich Clostridium DNA. Touchdown PCR may help with specificity.

  • Cloning strategies: Several options are suitable:

    • Restriction enzyme-based cloning into appropriate vectors

    • Gibson Assembly for seamless cloning

    • Golden Gate Assembly using BsaI sites as demonstrated with the pQmod-GG plasmid series for C. phytofermentans

  • Vector selection: For expression in C. phytofermentans, consider the pQmod series plasmids with appropriate Gram-positive origins (pBP1, pCB102) and antibiotic resistance markers (ermB, catP, aad9) . For E. coli expression, pET vectors with T7 promoter systems are recommended.

  • Transformation: For C. phytofermentans, electroporation protocols have been optimized using:

    • Cell growth to early-mid log phase

    • Cell wall weakening with glycine or lysozyme

    • Electroporation in an anaerobic chamber

    • Recovery in rich media before plating on selective media

What purification strategies are optimal for recombinant ATP synthase subunit b?

Purification of recombinant ATP synthase subunit b presents challenges due to its membrane-association and extended coiled-coil structure. The following strategy is recommended:

  • Expression systems:

    • For full-length protein: E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • For soluble domain studies: Consider expressing only the soluble portion (without the N-terminal transmembrane domain)

  • Solubilization strategies:

    • For full-length protein: Mild detergents like DDM (n-dodecyl-β-D-maltoside), LMNG, or digitonin

    • Buffer screening to identify optimal solubilization conditions

  • Purification workflow:

    • IMAC (immobilized metal affinity chromatography) using His-tagged protein

    • Ion exchange chromatography (typically anion exchange as subunit b is generally acidic)

    • Size exclusion chromatography for final polishing and removal of aggregates

  • Quality control:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry for accurate mass determination

    • Circular dichroism to confirm secondary structure (expected high α-helical content)

    • Dynamic light scattering to assess monodispersity

  • Stability considerations:

    • Addition of glycerol (10-20%) to prevent aggregation

    • Testing various pH conditions (typically pH 7-8 is optimal)

    • Consideration of reducing agents if cysteine residues are present

What functional assays can validate the activity of recombinant ATP synthase subunit b?

As subunit b is a structural component rather than a catalytic subunit, functional validation requires assessing its correct folding and ability to interact with partner proteins:

  • Structural integrity assays:

    • Circular dichroism to confirm α-helical secondary structure

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to identify properly folded domains

  • Protein-protein interaction assays:

    • Pull-down assays with other ATP synthase subunits (particularly subunit δ)

    • Surface Plasmon Resonance (SPR) to quantify binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters of interactions

  • Complementation studies:

    • Expression of C. phytofermentans atpF in E. coli unc operon mutants lacking functional subunit b

    • Assessment of ATP synthesis and growth phenotypes

  • Reconstitution experiments:

    • Incorporation of purified subunit b into liposomes with other ATP synthase components

    • Measurement of ATP synthesis or proton pumping in reconstituted systems

  • Dimerization assessment:

    • Analytical ultracentrifugation to confirm dimeric state

    • Cross-linking studies to assess dimer formation efficiency

How can CRISPR-Cas systems be adapted for studying atpF function in C. phytofermentans?

CRISPR-Cas technology offers powerful approaches for studying gene function in C. phytofermentans:

  • System selection: Cas12a (formerly Cpf1) has been successfully adapted for use in C. phytofermentans . The system utilizes:

    • PGusA2-TetO2/1 promoter for inducible Cas12a expression

    • miniPthl promoter for tetR expression

    • Specific gRNA cassette optimized for Clostridium

  • Targeting strategies:

    • Gene knockout: Design gRNAs targeting early in the atpF coding sequence

    • CRISPRi: Use catalytically inactive dCas12a to repress atpF expression without genome editing

  • Delivery method:

    • Plasmid pQdC12a has been developed for C. phytofermentans using the pQmod3C-GG backbone, providing a suitable delivery vector for CRISPR components

  • Experimental approaches:

    • Conditional knockdown: Using the tetracycline-inducible system to control dCas12a expression, allowing titrated repression of atpF

    • Functional complementation: Simultaneous expression of wild-type or mutant atpF variants while knocking down the endogenous gene

    • Phenotypic analysis: Monitoring growth, ATP levels, membrane potential, and other physiological parameters

  • Validation methods:

    • RT-qPCR to confirm reduced atpF transcript levels

    • Western blotting to detect reduced protein levels

    • ATP synthesis assays to quantify functional impact

This approach allows for precise dissection of atpF function in the native C. phytofermentans context, providing insights that may not be obtainable in heterologous systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.