Recombinant Clostridium phytofermentans Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we currently have in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Cphy_1107; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) (Clostridium phytofermentans)
Target Names
cobS
Target Protein Sequence
MKWLNSLWIAFSMYSKIRVPMKEWEESSMRYAICFFPLIGAVIGGVFFLTFQIGHLLKLG DILIAALLTSIPILISGGIHMDGYCDTMDAISSYQSKERRLEILKDPHSGAFAIIRSGVY FLLYFGMVSVLTLKSSIIIAIFFVVSRALSGLAVVQFKTAKSNGLVATFQQAAHKRKVTI SMVIYLVITVIGMLLVSPILTVVGMLTALLCFIRYKKLAYQLFGGTTGDLAGYFLVRCEL MAGLAVVIAEGVIIYGTGHWW
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what role does it play in vitamin B12 biosynthesis?

Cobalamin synthase (CobS) is a critical enzyme in the complex biosynthetic pathway of vitamin B12 (cobalamin). It functions as a cobalamin 5′-phosphate synthase (TIGR01650) and forms part of the cobalt chelatase complex in aerobic pathways. The complete synthesis of cobalamin involves approximately 30 enzymatic steps, with CobS playing a crucial role in the later stages of the biosynthetic process .

Methodologically, researchers typically characterize CobS function through:

  • Gene deletion and complementation studies

  • Protein purification and enzymatic assays

  • In vitro reconstitution of the cobalamin biosynthetic pathway

  • Structural studies of CobS and its interaction partners

What are the characteristics of Clostridium phytofermentans as a host organism?

Clostridium phytofermentans (also called Lachnoclostridium phytofermentans) is an obligately anaerobic, rod-shaped, spore-forming, Gram-positive bacterium belonging to the family Lachnospiraceae. It has emerged as a valuable model organism due to its ability to ferment diverse plant polysaccharides including cellulose, hemicellulose, and pectin to produce ethanol, acetate, and hydrogen .

Key characteristics that make it suitable for recombinant protein expression include:

  • Fully sequenced 4.8 Mb genome with over 170 enzymes in the CAZy database

  • Anaerobic metabolism suitable for oxygen-sensitive processes

  • Well-developed genetic tools including transformation protocols

  • Ability to utilize plant biomass as a carbon source

What transformation methods are available for C. phytofermentans?

Recent advances have made genetic manipulation of C. phytofermentans more accessible. A simple benchtop electroporation method has been developed that enables identification of replicating plasmids and resistance markers that can be cotransformed into C. phytofermentans .

The general protocol involves:

  • Preparation of electrocompetent cells under anaerobic conditions

  • Electroporation with optimized parameters for C. phytofermentans

  • Recovery in appropriate media

  • Selection using antibiotic resistance markers

This method has been validated by successful transformation with various plasmid constructs and serves as the foundation for genetic engineering in this organism.

What are the potential challenges when overexpressing CobS in bacterial systems?

Research in related systems (specifically E. coli) indicates that overexpression of cobamide synthase can present significant challenges. High levels of CobS protein have been shown to:

  • Dissipate the proton motive force (PMF)

  • Compromise membrane stability

  • Arrest cellular growth

  • Eventually lead to cell death

These effects were demonstrated experimentally using ethidium bromide (EtBr) accumulation assays, which showed increased EtBr uptake in cells overproducing CobS, indicating membrane disruption . Both active (wild-type) and inactive (D82A mutant) CobS proteins exhibited these detrimental effects, suggesting the impact is related to protein accumulation rather than enzymatic activity.

CobS VariantEtBr AccumulationCell ViabilityPMF Maintenance
Wild-type (active)Significantly increasedSeverely reducedCompromised
D82A (inactive)Significantly increasedSeverely reducedCompromised
Control (no overexpression)BaselineNormalMaintained

These findings highlight the importance of carefully controlling expression levels when working with recombinant CobS in any bacterial system, including C. phytofermentans.

How can the negative effects of CobS overexpression be mitigated?

Research suggests several strategies to counteract the detrimental effects of CobS overproduction:

  • Balanced coexpression of partner proteins:
    Studies have demonstrated that coexpression of CobC (the phosphatase catalyzing the last reaction of CoB12 biosynthesis) or PspA (phage shock protein A) with CobS significantly ameliorates the negative effects on cell viability and membrane integrity .

  • Development of an optimized expression system:
    Careful control of induction parameters and promoter strength can help maintain CobS at levels that don't compromise cellular function.

  • Formation of a multienzyme complex:
    Evidence suggests that CobS functions within a multienzyme complex anchored by CobS and potentially CbiB that catalyzes the late steps of CoB12 biosynthesis. In vitro studies have shown that the association of CobC phosphatase with liposomes depends on the presence of CobS in the liposome .

What genetic tools are available for optimizing CobS expression in C. phytofermentans?

Several sophisticated genetic tools have been developed for fine-tuning gene expression in C. phytofermentans:

  • Promoter libraries:
    A series of promoters spanning a >100-fold expression range has been developed by testing a promoter library driving the expression of a luminescent reporter . This enables selection of an appropriate expression level for CobS.

  • Tetracycline-responsive expression system:
    By insertion of tetracycline operator (tet) sites upstream of target genes, expression can be quantitatively altered using the Tet repressor and anhydrotetracycline (aTc) . This allows for inducible, titratable expression control.

  • CRISPR interference (CRISPRi) system:
    An aTc-regulated dCas12a system has been demonstrated for in vivo CRISPRi-mediated repression of target genes in C. phytofermentans . This provides an additional layer of control for regulating CobS expression.

How do synthetic promoters function in Clostridium species?

Studies in C. acetobutylicum have provided valuable insights into the development and functionality of synthetic promoters in Clostridium species. These findings can inform approaches for C. phytofermentans:

What is the structure of the cobalamin biosynthetic pathway in anaerobic bacteria?

The cobalamin biosynthetic pathway in anaerobic bacteria like C. phytofermentans differs from that in aerobic organisms:

  • Key enzymes and complexes:

    • In anaerobic organisms like Salmonella typhimurium and Bacillus megaterium, cobalt insertion is catalyzed by ATP-independent enzymes CbiK/X

    • This contrasts with the ATP-dependent CobNST complex found in aerobic organisms like Pseudomonas denitrificans

  • Nomenclature challenges:

    • The enzymes designated as CobT, CobU, and CobS in the anaerobic pathway are non-homologous to those with the same names in the aerobic pathway, due to their discovery history

    • This creates potential confusion when comparing pathways across species

  • Methylation steps:

    • The anaerobic pathway includes several SAM-dependent methylation steps catalyzed by enzymes such as CbiL, CbiH, and others

    • These enzymes create the complex corrin ring structure characteristic of cobalamin

What experimental protocols are recommended for characterizing recombinant CobS activity?

For researchers investigating recombinant CobS from C. phytofermentans, we recommend:

  • Expression optimization:

    • Test multiple promoters from the established library to identify optimal expression levels

    • Consider coexpression with CobC and/or PspA to enhance stability and function

    • Monitor cellular health parameters during expression

  • Protein purification:

    • Use anaerobic techniques throughout purification due to oxygen sensitivity

    • Consider membrane-associated purification approaches as CobS appears to interact with membranes

    • Test both detergent-based extraction and liposome reconstitution methods

  • Activity assays:

    • Develop coupled enzymatic assays to monitor the conversion of precorrin intermediates

    • Consider HPLC or LC-MS approaches to detect pathway intermediates and products

    • Investigate the requirement for other pathway components for full activity

How can CRISPR-based methods be used to study CobS function in C. phytofermentans?

The recently developed aTc-regulated dCas12a system for C. phytofermentans provides powerful tools for studying CobS function:

  • CRISPRi-mediated repression:

    • Design guide RNAs targeting cobS or other genes in the cobalamin biosynthetic pathway

    • Use the established aTc-regulated dCas12a system for controlled gene repression

    • Monitor the impact on cobalamin production and cellular metabolism

  • Genome editing:

    • Potentially adapt the CRISPR system for targeted genome modifications

    • Create precise mutations in cobS to study structure-function relationships

    • Generate reporter fusions to study expression patterns and regulation

This system represents a significant advancement in genetic manipulation capabilities for C. phytofermentans and opens new avenues for studying the cobalamin biosynthetic pathway .

What are the key knowledge gaps in understanding CobS function?

Despite progress in characterizing cobalamin biosynthesis, several important questions remain:

  • Structural biology:

    • High-resolution structures of CobS from anaerobic organisms are needed

    • The membrane association mechanism requires clarification

    • The multienzyme complex architecture remains poorly understood

  • Regulatory mechanisms:

    • How is cobS expression regulated in response to cobalt availability?

    • What transcription factors control expression of the cobalamin biosynthetic genes?

    • How is the pathway integrated with broader cellular metabolism?

  • Evolutionary aspects:

    • Why do anaerobic and aerobic pathways use non-homologous enzymes with the same designations?

    • How has the pathway evolved across different clostridial species?

How might synthetic biology approaches enhance recombinant cobalamin production?

Future research could explore several synthetic biology strategies:

  • Pathway optimization:

    • Balance expression of all enzymes in the cobalamin biosynthetic pathway

    • Identify and alleviate rate-limiting steps

    • Engineer feedback-resistant variants of key enzymes

  • Chassis engineering:

    • Modify C. phytofermentans to enhance precursor availability

    • Develop strains with improved tolerance to CobS expression

    • Create genetic circuits for dynamic regulation of pathway genes

  • Multienzyme complex engineering:

    • Design synthetic scaffolds to co-localize pathway enzymes

    • Optimize stoichiometry of complex components

    • Create fusion proteins to enhance pathway efficiency

These approaches could potentially overcome current limitations in recombinant cobalamin production and advance both fundamental understanding and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.