Recombinant Clostridium phytofermentans Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant CbiM is a full-length, His-tagged membrane protein (UniProt ID: A9KP98) expressed in E. coli . It spans residues 27–250 and belongs to the CbiMNQO transporter complex, a group-I ECF transporter responsible for cobalt uptake in Clostridium phytofermentans . Key features include:

PropertyDetail
Molecular Weight~22.5 kDa (predicted)
Expression SystemE. coli with N-terminal His tag
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C
Functional RoleSubstrate-binding component (EcfS) of the cobalt-specific ECF transporter

Domain Architecture

CbiM contains seven transmembrane helices, distinguishing it from group-II ECF transporters (e.g., FolT with six helices) . Structural studies reveal:

  • An inward-open conformation in the CbiMQO subcomplex (CbiM + CbiQ + CbiO) .

  • A substrate-gating L1 loop critical for cobalt coordination .

ATPase Activity and Transport Mechanism

  • CbiM stimulates ATP hydrolysis by the CbiQO complex, independent of cobalt binding .

    • Basal ATPase activity: kcat=2.5min1k_{\text{cat}} = 2.5 \, \text{min}^{-1}, Km=277.3μMK_m = 277.3 \, \mu\text{M} .

  • CbiN, though essential for transport, does not affect ATPase activity, suggesting a dynamic regulatory role .

Substrate Specificity

  • Cobalt uptake: ~10× higher activity than nickel .

  • Mutagenesis (e.g., H2D mutation in CbiM) abolishes cobalt binding but retains ATPase stimulation .

Expression and Assembly

  • Genes (cbiM, cbiN, cbiQ, cbiO) are co-expressed in E. coli using pETDuet and pRSFDuet vectors .

  • The stable CbiMQO subcomplex (1:1:2 molar ratio) forms even without CbiN .

Purification Challenges

  • CbiN shows weak interaction with CbiMQO, leading to its gradual loss during purification .

  • His-tagged CbiQ enables affinity chromatography, yielding high-purity complexes .

Biotechnological Relevance

  • Cobalt assimilation: Essential for enzymes like cobalt-dependent metalloproteases and hydrogenases .

  • Biofuel production: C. phytofermentans leverages cobalt transporters for biomass-to-biofuel pathways .

Comparative Genomics

  • CbiM homologs (e.g., NikM in nickel transporters) share structural motifs but differ in substrate-binding loops .

Significance and Future Directions

Recombinant CbiM provides a model for studying group-I ECF transporters, which are undercharacterized compared to group-II systems . Key unanswered questions include:

  • The precise role of CbiN in coupling conformational changes .

  • Engineering CbiM for enhanced cobalt affinity in bioremediation or bioenergy applications .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbiM; Cphy_1385; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-250
Protein Length
Full Length of Mature Protein
Species
Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) (Clostridium phytofermentans)
Target Names
cbiM
Target Protein Sequence
AMHIMEGYLPPKYCITWGILSIPFLVAGYFSIKKTVSKQHRSITMLAMAGAFVFVLSSLK IPSVTGSCSHMTGTGLGAILFGPSAVSILGIIVLIFQAILLAHGGLTTLGANTFSMAIAG PFVSFGIYKLCQKLKVNKLSGIFLAAFVGDLFTYCVTSIQLALAYPSSNGGVGASALKFL AVFAPTQVPLAIIEGILTVVIMIGLETYAKAELNDLGLVNGGIN
Uniprot No.

Target Background

Function
CbiM is a component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Clostridium phytofermentans Cobalt transport protein CbiM and what is its role in bacterial metabolism?

Clostridium phytofermentans Cobalt transport protein CbiM (UniProt ID: A9KP98) functions as the substrate-binding component of the CbiMNQO transport complex, which is classified as a group-I Energy Coupling Factor (ECF) transporter. CbiM is specifically responsible for cobalt ion uptake, which is essential for various metabolic processes including vitamin B12 (cobalamin) biosynthesis .

The protein is horizontally positioned along the lipid membrane with its transmembrane helices arranged roughly parallel to the membrane plane. Within the CbiMNQO complex, CbiM corresponds functionally to the EcfS component of group-II ECF transporters, while CbiN, CbiQ, and CbiO correspond to other structural components of the transport system .

What expression systems are recommended for producing functional recombinant CbiM?

For laboratory-scale production of recombinant CbiM, Escherichia coli expression systems have proven effective. The protein can be successfully expressed in E. coli with an N-terminal His-tag, which enables efficient purification using affinity chromatography .

When designing expression constructs, researchers should consider:

  • Using the mature protein sequence (amino acids 27-250) rather than the full-length protein to improve solubility

  • Incorporating appropriate signal sequences if membrane localization studies are intended

  • Optimizing codon usage for E. coli expression

  • Including a cleavable purification tag (His-tag) for downstream applications that require native protein

The expression conditions should be optimized with lower temperatures (16-25°C) after induction to increase the proportion of properly folded membrane protein.

What are the recommended storage and handling protocols for purified CbiM protein?

Purified recombinant CbiM should be stored according to the following guidelines for optimal stability and activity:

  • The lyophilized protein powder should be stored at -20°C to -80°C upon receipt

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommendation is 50%) for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity and function

The storage buffer typically consists of a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

How does CbiM function within the CbiMNQO transporter complex and what mechanisms govern cobalt transport?

CbiM operates as part of the quaternary CbiMNQO complex, where each component plays a distinct role in the ATP-dependent transport of cobalt ions. Based on structural and functional analyses, the following mechanisms have been elucidated:

  • CbiM serves as the substrate-binding subunit that specifically recognizes and binds cobalt ions

  • CbiM has been shown to stimulate the basal ATPase activity of the CbiQO components

  • The transport process involves conformational changes including rotation or toppling of both CbiQ and CbiM components

  • CbiN appears to function as a coupling protein that transfers conformational changes between CbiQ and CbiM

  • The L1 loop of CbiM acts as a substrate gate, controlling access to the transport channel

The transport cycle begins with substrate binding to CbiM, followed by ATP binding to CbiO, which triggers conformational changes throughout the complex. These changes facilitate the translocation of cobalt ions across the membrane, followed by ATP hydrolysis and a return to the ground state.

What methodologies are most effective for studying CbiM-mediated cobalt transport in vitro?

Several complementary approaches can be employed to study CbiM-mediated cobalt transport:

  • Liposome Reconstitution Assays:

    • Purified CbiMNQO components can be reconstituted into liposomes

    • Transport can be measured using radioactive 57Co or fluorescent cobalt-binding probes

    • ATP-dependent accumulation of cobalt inside the liposomes indicates functional transport

  • ATPase Activity Assays:

    • Measuring phosphate release using colorimetric methods (e.g., malachite green assay)

    • Comparing ATPase activity of CbiO alone versus the CbiMQO or complete CbiMNQO complex

    • This approach has demonstrated that CbiM stimulates the ATPase activity of CbiQO components

  • Structural Studies:

    • X-ray crystallography of individual components and subcomplexes

    • Cryo-electron microscopy of the entire CbiMNQO complex

    • These methods have revealed the inward-open conformation of the CbiMQO complex and ATP-bound closed conformation of CbiO

  • Site-Directed Mutagenesis:

    • Targeting key residues in the L1 loop of CbiM to assess substrate gating

    • Modifying the interface between CbiM and CbiQ to understand coupling mechanisms

    • Creating chimeric proteins to identify substrate specificity determinants

How can genetic manipulation of C. phytofermentans be optimized for CbiM functional studies?

Genetic manipulation of Clostridium phytofermentans for CbiM studies can be approached using several strategies based on recent advances in clostridial genetics:

  • Plasmid Selection and Design:

    • pBP1 and pCB102 Gram-positive origins have shown effectiveness in C. phytofermentans

    • Several antibiotic resistance markers are available, including ermB (erythromycin), catP (chloramphenicol), aad9 (spectinomycin), and tetA (tetracycline)

    • The following plasmids have been optimized for C. phytofermentans:

    PlasmidResistanceGram+ OriginApplications
    pQmod2EermBpBP1Expression studies
    pQmod2CcatPpBP1Genetic complementation
    pQmod3Saad9pCB102Protein localization
    pQmod3E-GGermBpCB102Golden Gate assembly
  • Transformation Protocol:

    • Electroporation appears effective without the need for DNA methylation protection

    • C. phytofermentans contains two type II restriction modification systems (Cphy0266–8 and Cphy2923–5) and one type IV restriction enzyme (Cphy1615), but they do not appear to impede electrotransformation

  • Gene Expression Systems:

    • For controlled expression of cbiM variants, inducible promoters can be employed

    • Golden Gate-compatible vectors (pQmod2E-GG, pQmod3S-GG) allow efficient assembly of complex genetic constructs

  • Phenotypic Analysis:

    • Growth on cobalt-limited media can be used to assess CbiM functionality

    • Expression profiling using microarray or RNA-seq can reveal compensatory responses to CbiM mutation

What is the relationship between CbiM function and bacterial microcompartment activity in C. phytofermentans?

While CbiM primarily functions in cobalt transport, research suggests an intriguing relationship with bacterial microcompartments (BMCs) in C. phytofermentans:

  • C. phytofermentans contains three loci encoding bacterial microcompartment shell proteins

  • One of these BMC loci is involved in the metabolism of fucose and rhamnose, producing ethanol, propanol, and propionate as major products

  • When grown on these deoxyhexose sugars, C. phytofermentans expresses operons coding for BMC proteins, sugar dissimilation enzymes, and ABC transporters

The potential connections between CbiM-mediated cobalt transport and BMC function may include:

  • Cobalt-dependent enzymes within BMCs that require CbiM-transported cobalt

  • Coordinated regulation of cobalt transport and BMC assembly

  • Potential colocalization of CbiM transporters near BMCs to facilitate direct delivery of cobalt to BMC-enclosed pathways

Experimental approaches to investigate these connections could include:

  • Co-immunoprecipitation studies to identify physical interactions between CbiM and BMC proteins

  • Fluorescent tagging to visualize the spatial relationship between CbiM and BMCs

  • Metabolic profiling of wild-type versus cbiM mutants when grown on fucose or rhamnose

How can structural information about CbiM be leveraged for protein engineering applications?

The structural insights gained from CbiM studies provide opportunities for protein engineering applications:

  • Engineering Substrate Specificity:

    • Modifying the substrate-binding residues of CbiM could potentially alter its specificity from cobalt to other divalent metal ions

    • Key regions to target include the L1 loop which functions in substrate gating

    • Structural comparison with other metal transporters can identify critical residues for mutagenesis

  • Designing Chimeric Transporters:

    • Creating fusion proteins between CbiM and other substrate-binding components

    • This approach could generate novel transporters with expanded substrate ranges

    • Design should preserve the critical interfaces between CbiM and other components of the transport complex

  • Stabilization for Structural Studies:

    • Introduction of disulfide bridges or mutations that lock CbiM in specific conformational states

    • These modifications can facilitate crystallization for high-resolution structural determination

    • Conformation-specific antibodies or nanobodies can be developed to stabilize transient states

  • Biosensor Development:

    • CbiM-based biosensors for detecting cobalt in environmental or biological samples

    • Coupling conformational changes in CbiM to optical or electrochemical reporting systems

    • Potential applications in monitoring heavy metal contamination in soil or water

What are common challenges in expressing and purifying functional CbiM protein?

Researchers commonly encounter several challenges when working with CbiM:

  • Expression Issues:

    • As a membrane protein, CbiM can form inclusion bodies in heterologous expression systems

    • Solution: Lower induction temperatures (16-20°C), use specialized E. coli strains (C41/C43), or employ mild detergents during lysis

  • Purification Challenges:

    • Detergent selection is critical for maintaining the native conformation of CbiM

    • Recommended approach: Screen multiple detergents (DDM, LMNG, CHAPS) for optimal extraction and stability

    • Purification should be performed at 4°C to minimize protein degradation

  • Functional Assessment:

    • Isolated CbiM may lose activity without its partner proteins (CbiN, CbiQ, CbiO)

    • Consider co-expression and co-purification of the entire CbiMNQO complex for functional studies

    • Liposome reconstitution may be necessary to accurately measure transport activity

How can researchers verify the functional integrity of recombinant CbiM?

Multiple complementary approaches can be used to verify that recombinant CbiM is functionally intact:

  • Binding Assays:

    • Isothermal titration calorimetry (ITC) to measure cobalt binding affinity

    • Fluorescence spectroscopy using cobalt-sensitive fluorophores

    • Surface plasmon resonance (SPR) to measure binding kinetics

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Limited proteolysis to verify proper folding

    • Size-exclusion chromatography to assess oligomeric state

  • Functional Reconstitution:

    • Proteoliposome-based transport assays with purified CbiMNQO components

    • Complementation of cbiM-deficient bacterial strains

    • Measurement of ATPase activity in reconstituted complexes

What emerging technologies could advance the understanding of CbiM function?

Several cutting-edge technologies hold promise for deepening our understanding of CbiM:

  • Cryo-Electron Microscopy:

    • Time-resolved cryo-EM to capture intermediate states during the transport cycle

    • This could reveal the complete conformational landscape of the CbiMNQO complex

  • Advanced Microscopy Techniques:

    • Single-molecule FRET to monitor real-time conformational changes in CbiM

    • High-speed atomic force microscopy to visualize dynamic structural transitions

  • Computational Approaches:

    • Molecular dynamics simulations of CbiM in membrane environments

    • Machine learning algorithms to predict substrate specificity determinants

    • In silico screening of small molecules that could modulate CbiM function

  • Synthetic Biology Applications:

    • Development of minimal synthetic cells with engineered CbiM-based transport systems

    • Creation of chimeric transporters with novel substrate specificities

    • Integration of CbiM into artificial membranes for biotechnological applications

How might CbiM research contribute to broader understanding of bacterial metabolism and applications in synthetic biology?

CbiM research has several potential broader impacts:

  • Metabolic Engineering:

    • Enhanced cobalt uptake systems could improve vitamin B12 production in engineered bacteria

    • Optimized metal transport could facilitate the development of bacterial bioremediation systems

  • Antibiotic Development:

    • CbiM and other ECF transporters represent potential novel antibiotic targets

    • Small molecules that inhibit CbiM function could disrupt essential cobalt-dependent processes

  • Synthetic Biology:

    • CbiM-based transport modules could be incorporated into synthetic microbial consortia

    • Engineered metal transport systems could enable new biosensing capabilities

  • Evolutionary Insights:

    • Comparative analysis of CbiM across bacterial species can illuminate the evolution of metal transport systems

    • Understanding how CbiM interfaces with bacterial microcompartments may reveal novel metabolic strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.