Recombinant Clostridium thermocellum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Clostridium thermocellum is a thermophilic, anaerobic bacterium known for its ability to break down cellulose, making it valuable in biofuel production from plant biomass . ATP synthase is an essential enzyme complex in cellular energy production, and its subunit b (atpF) plays a critical role in its function. The recombinant form of this subunit is produced using genetic engineering techniques, allowing for detailed study and potential applications in biotechnology.

ATP Synthase and Subunit b Function

ATP synthase, also known as F1F0-ATPase, uses a proton gradient across the cell membrane to synthesize ATP from ADP and inorganic phosphate. This enzyme complex consists of two main parts: the F0 sector, embedded in the membrane, and the F1 sector, located in the cytoplasm. Subunit b (atpF) is a key component of the F0 sector, acting as a structural link between the F1 and F0 components .

Role of atpF in C. thermocellum

In C. thermocellum, the atpF gene encodes the subunit b of the ATP synthase. This subunit is essential for the proper assembly and function of the ATP synthase complex, which is crucial for the bacterium's energy metabolism, especially during cellulose degradation . The expression of atpF and other ATP synthase genes can be influenced by various factors, including carbon source availability and metabolic stress .

Recombinant Production and Study

Producing recombinant C. thermocellum ATP synthase subunit b (atpF) involves cloning the atpF gene into a suitable expression vector and introducing it into a host organism, such as Escherichia coli, for protein production. The recombinant protein can then be purified and used for various studies, including:

  • Structural Analysis: Determining the three-dimensional structure of the subunit to understand its interactions with other components of the ATP synthase complex.

  • Functional Assays: Assessing the role of specific amino acid residues in subunit b function through site-directed mutagenesis and activity measurements.

  • Inhibitor Binding Studies: Identifying and characterizing inhibitors that target subunit b, which could lead to the development of new antibacterial agents or tools for manipulating bacterial metabolism .

Impact of Metabolic Stress on ATP Synthase

C. thermocellum's metabolism and ATP production are affected by the presence of various sugars. For example, the presence of xylose, which C. thermocellum cannot catabolize efficiently, inhibits its growth and increases the expression of genes related to xylose uptake, potentially imposing an energy penalty on the cell .

Potential Applications

Understanding the structure, function, and regulation of C. thermocellum ATP synthase subunit b (atpF) has several potential applications:

  • Biofuel Production: Optimizing the energy metabolism of C. thermocellum to improve its efficiency in converting cellulose to ethanol and other biofuels .

  • Antibacterial Drug Development: Targeting ATP synthase, including subunit b, with specific inhibitors to combat bacterial infections .

  • Biotechnology: Using recombinant subunit b as a tool for studying ATP synthase function and developing novel biotechnological applications.

Tables

FeatureDescription
GeneatpF
ProteinATP synthase subunit b
OrganismClostridium thermocellum
FunctionStructural component of ATP synthase, linking F1 and F0 sectors
Recombinant ProductionCloning atpF into an expression vector and producing the protein in a host organism (e.g., E. coli)
ApplicationsBiofuel production, antibacterial drug development, biotechnology

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; Cthe_2604; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Ruminiclostridium thermocellum)
Target Names
atpF
Target Protein Sequence
MLQENFVSCSKEREVQLAVLSEFIHIPTFIYTALNLVILYFILKRLLFKPVWEFMENRKN SIAESMEKAEKGKAEALELKNKYESELNEAYAKAQKILKEAEEKAKQEYERIIRDAKNEA EALKLKAKEEIEREKNEALKEIRNEVVSLALEAASKVLEANMDTEENRKLVNRFIDEQGV A
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Clostridium thermocellum ATP synthase subunit b (atpF) and what is its role in cellular metabolism?

ATP synthase subunit b, encoded by the atpF gene in Clostridium thermocellum, is a critical component of the F0 portion of the F1F0-ATP synthase complex. This subunit forms part of the peripheral stalk that connects the membrane-embedded F0 domain to the catalytic F1 domain. This connection is essential for the mechanical coupling between proton translocation across the membrane and ATP synthesis.

In C. thermocellum, ATP synthesis is intricately linked to the organism's anaerobic, thermophilic lifestyle and its ability to degrade cellulosic biomass. The bacterium balances several ATP-producing metabolic processes, including:

  • Intracellular phosphorolytic cleavage of β-glucosidic bonds

  • Glycolysis via the Emden-Meyerhoff pathway

  • Acetate kinase activity

These processes must offset ATP-consuming functions such as substrate transport via adenosine-binding cassette (ABC) systems, cell synthesis, cellulase production, and maintenance functions . ATP synthase plays a crucial role in maintaining this energetic balance during growth on cellulosic substrates.

What is known about gene regulation of atpF in C. thermocellum under different growth conditions?

The regulation of atpF expression in C. thermocellum appears to be integrated with the organism's carbon metabolism and energy requirements, though specific regulatory mechanisms remain to be fully elucidated. Transcriptomic analyses have provided insights into how ATP-related genes respond to different growth conditions:

When comparing growth on different carbon sources (xylose versus cellobiose), research has shown that several genes involved in "oxidation-reduction processes, ATP binding and ATPase activity, and integral components of the membrane" are differentially expressed . This suggests that ATP synthase genes, potentially including atpF, are responsive to the carbon source.

The expression of energy metabolism genes in C. thermocellum is also linked to cellulosome production. Studies have demonstrated that "the inducing effect of cellobiose (G2) and cellulose on cellulosome production could be eliminated by deletion of transporter B genes" , indicating a regulatory network connecting carbon uptake, energy metabolism, and cellular machinery.

A comprehensive understanding of atpF regulation would require targeted studies examining:

  • Promoter architecture and transcription factor binding sites

  • Response to nutrient limitation and stress conditions

  • Coordination with other ATP synthase subunit genes

  • Post-transcriptional regulatory mechanisms

What expression systems and conditions are optimal for producing functional recombinant C. thermocellum ATP synthase subunit b?

The successful expression of functional recombinant C. thermocellum ATP synthase subunit b requires careful consideration of host systems and conditions. Based on research with similar thermophilic membrane proteins, the following strategies are recommended:

Expression Systems:

Expression Conditions:

  • Temperature: Despite the thermostability of the target protein, lower induction temperatures (15-25°C) often improve folding efficiency

  • Induction: Gradual induction using low IPTG concentrations (0.1-0.5 mM) or auto-induction media

  • Media supplementation: Addition of glycylglycine (50-100 mM) to prevent pH drop during high-density growth

  • Co-expression: Consider chaperone co-expression, particularly for the full ATP synthase complex

The availability of recombinant C. thermocellum ATP synthase subunit b from commercial suppliers indicates that viable expression systems have been established, though proprietary details of these systems are not widely published.

What are the most effective methods for studying interactions between ATP synthase subunit b and other components of the ATP synthase complex?

Investigating protein-protein interactions within the ATP synthase complex requires specialized approaches due to the membrane-associated nature of these proteins. Effective methodologies include:

In vitro Interaction Analysis:

  • Surface Plasmon Resonance (SPR): Can determine binding kinetics between purified components, requires immobilization strategies compatible with membrane proteins

  • Isothermal Titration Calorimetry (ITC): Provides complete thermodynamic profiles of interactions, particularly useful for studying ATP/ADP binding dynamics

  • Cross-linking Mass Spectrometry (XL-MS): Identifies interaction interfaces through chemical cross-linking followed by mass spectrometric analysis

  • Microscale Thermophoresis (MST): Measures interactions in solution with minimal protein requirements and detergent compatibility

In vivo Interaction Analysis:

  • Bacterial Two-Hybrid Systems: Modified for membrane protein analysis, particularly suitable for scanning interaction domains

  • Förster Resonance Energy Transfer (FRET): For real-time monitoring of interactions in reconstituted systems or intact cells

  • Co-immunoprecipitation: Using affinity-tagged versions of subunit b to pull down interaction partners

Validation Approaches:

  • Mutagenesis: Site-directed mutations at predicted interaction interfaces, followed by functional assays

  • Complementation Assays: Testing if expression of wild-type or mutant versions restores function in deletion strains

  • In silico Docking: Computational prediction of interaction interfaces guided by experimental constraints

Similar complementation approaches have been successful with C. thermocellum proteins, where "the respective phenotype can be restored by using plasmid-based expression of the transporter genes" , suggesting such methods would be applicable to ATP synthase studies.

What analytical techniques provide the most comprehensive structural information about recombinant C. thermocellum ATP synthase subunit b?

A multi-technique approach is required to obtain comprehensive structural information about recombinant C. thermocellum ATP synthase subunit b:

High-Resolution Structural Techniques:

TechniqueInformation ObtainedAdvantagesLimitations
X-ray CrystallographyAtomic-level resolution, precise side chain positionsHighest possible resolutionChallenging for membrane proteins, requires crystals
Cryo-Electron Microscopy3D structure in near-native state, conformational ensemblesWorks with smaller sample amounts, captures different statesLower resolution for small subunits in isolation
NMR SpectroscopySolution structure, dynamics informationProvides information on flexibility and interactionsSize limitations, complex spectra for membrane proteins

Complementary Approaches:

The search results mention successful crystallographic studies of C. thermocellum proteins, including an ATPase component where "The crystal structure of the ATPase was solved" , demonstrating the feasibility of applying these techniques to thermophilic proteins from this organism.

How can researchers troubleshoot common issues in recombinant ATP synthase subunit b expression and purification?

Researchers frequently encounter challenges when working with recombinant ATP synthase subunit b. The following troubleshooting guide addresses common issues and their solutions:

Low Expression Yields:

ProblemPossible CausesSolutions
Minimal protein detectionToxicity to host cellsUse tightly controlled induction systems; switch to specialized strains (C41/C43)
Protein degradationAdd protease inhibitors; use protease-deficient strains
Poor translationOptimize codon usage; reduce secondary structure in mRNA
Poor solubilityImproper foldingLower induction temperature; co-express with chaperones
Inefficient membrane integrationUse specialized membrane protein expression strains

Purification Challenges:

ProblemPossible CausesSolutions
Poor detergent extractionSuboptimal detergent choiceSystematic detergent screening; try detergent mixtures
Insufficient extraction timeExtend solubilization period (4-12 hours) at appropriate temperature
Aggregation during purificationDetergent concentration too lowMaintain detergent above critical micelle concentration
Protein instabilityAdd stabilizers (glycerol, specific lipids, salt)
Loss of binding partnersHarsh purification conditionsUse milder elution conditions; consider tandem affinity purification
Detergent disruption of interactionsTry digitonin or other interaction-preserving detergents

Activity and Stability Issues:

ProblemPossible CausesSolutions
Low thermostabilityImproper buffer conditionsOptimize pH, salt concentration, and specific ions
Absence of essential lipidsAdd specific lipids or use lipid nanodiscs for reconstitution
Poor activityDetergent inhibitionReconstitute into liposomes or nanodiscs for activity assays
Missing interaction partnersCo-express with other ATP synthase components

These approaches have been successful for other challenging C. thermocellum proteins, as evidenced by studies where researchers achieved protein purification suitable for crystallographic analysis .

What experimental design considerations are essential for comparing wild-type and mutant forms of ATP synthase subunit b?

When designing experiments to compare wild-type and mutant forms of ATP synthase subunit b, several critical factors must be addressed to ensure valid and reproducible results:

Mutation Selection Strategy:

  • Structure-guided approach:

    • Target conserved residues identified through sequence alignment

    • Focus on interface regions predicted to interact with other ATP synthase components

    • Select thermostability determinants based on comparative analysis with mesophilic homologs

  • Characterization hierarchy:

    • Begin with conservative substitutions (similar physicochemical properties)

    • Progress to more disruptive mutations after establishing analysis pipeline

    • Include both site-specific mutations and domain swaps/chimeras for comprehensive analysis

Expression and Purification Controls:

  • Expression consistency:

    • Express wild-type and mutant constructs under identical conditions

    • Verify similar expression levels through quantitative Western blotting

    • Ensure batch-to-batch consistency with appropriate controls

  • Purification standardization:

    • Use identical purification protocols for all variants

    • Verify comparable purity through rigorous analytical methods

    • Characterize oligomeric state to confirm proper assembly

Analytical Considerations:

Similar complementation approaches have been successful with other C. thermocellum proteins, where "the respective phenotype can be restored by using plasmid-based expression of the transporter genes" , providing a template for ATP synthase studies.

How does ATP synthase function integrate with the cellulosome system in C. thermocellum?

The integration of ATP synthase function with the cellulosome system in C. thermocellum represents a sophisticated example of metabolic coordination in a specialized organism. This relationship has several key dimensions:

Energetic Coupling:
ATP synthase activity must be precisely balanced with the energy demands of cellulosome production and function. The cellulosome—C. thermocellum's extracellular enzyme complex for cellulose degradation—requires significant energy investment for its synthesis, secretion, and regulation.

Research has established that ATP-consuming processes in C. thermocellum include "substrate transport via an adenosine-binding cassette system, cell synthesis, cellulase synthesis, and nonbiosynthetic 'maintenance' functions" . The substantial protein synthesis required for cellulosome production represents a major ATP investment that must be balanced by ATP synthase activity.

Regulatory Coordination:
Evidence suggests coordinated regulation between carbon uptake, energy metabolism, and cellulosome production. The search results reveal that "the inducing effect of cellobiose (G2) and cellulose on cellulosome production could be eliminated by deletion of transporter B genes, suggesting the coupling of sugar transport and regulation of cellulosome components" .

While ATP synthase is not directly mentioned in this regulatory network, as a central component of energy metabolism, it likely responds to the same regulatory signals that control cellulosome expression, creating an integrated response system to carbon availability.

  • Cellulosome activity releases cellodextrins of various lengths

  • Transported cellodextrins yield different ATP returns based on length

  • ATP availability influences cellulosome production

  • Cellulosome abundance affects cellodextrin release rates

This cycle creates a self-regulating system responsive to substrate availability and energetic constraints.

What role does ATP synthase play in the bioenergetics of cellulose utilization by C. thermocellum?

ATP synthase occupies a central position in the complex bioenergetics of cellulose utilization by C. thermocellum, balancing multiple ATP-producing and ATP-consuming pathways:

ATP Generation Pathways:
In C. thermocellum, several metabolic routes contribute to ATP production:

  • Intracellular phosphorolytic cleavage of β-glucosidic bonds by cellodextrin and cellobiose phosphorylases

  • Glycolysis via the Emden-Meyerhoff pathway

  • The action of acetate kinase

These processes generate ATP with varying efficiencies depending on the substrates utilized. Research has established that for cellodextrins with degree of polymerization n, the ATP yield follows the formula (n-1)/n, meaning longer cellodextrins provide more ATP per glucose equivalent .

ATP Consumption Requirements:
Several cellular processes require ATP investment:

  • Substrate transport via ABC transporters (1 ATP per cellodextrin transported)

  • Cellulosome synthesis and export

  • Cell growth and division

  • Maintenance energy requirements

Experimental determination of growth yield and maintenance parameters has established values of YTrue = 16.44 g cell/mol ATP and m = 3.27 mmol ATP/g cell per hour , providing quantitative constraints on cellular energetics.

Energy Conservation Strategies:
C. thermocellum has evolved specialized strategies for energy conservation during cellulose utilization:

  • Preference for assimilating longer cellodextrins when available

  • Integration of ATP-generating reactions with phosphorolytic cleavage of β-glucosidic bonds

  • Balancing of acetate production (which generates ATP) with other fermentation products

ATP synthase functions within this metabolic network to maintain proper ATP/ADP ratios and contribute to the proton motive force, particularly under energy-limited conditions.

How can manipulating ATP synthase activity enhance biofuel production in engineered C. thermocellum strains?

Strategic modification of ATP synthase activity represents a promising approach for enhancing biofuel production in engineered C. thermocellum strains through several potential mechanisms:

Energy Efficiency Optimization:
Modulating ATP synthase activity could improve the efficiency of ATP production and utilization, with several benefits for biofuel production:

  • Increased cellular energy availability for product synthesis

  • Reduced ATP consumption for maintenance functions

  • Improved growth under energy-limited conditions

Research has established quantitative parameters for C. thermocellum energy metabolism, including yield and maintenance coefficients (YTrue = 16.44 g cell/mol ATP and m = 3.27 mmol ATP/g cell per hour) , providing targets for optimization.

Metabolic Flux Redirection:
Altered ATP synthase activity could redistribute metabolic fluxes toward desired biofuel pathways:

ATP Synthase ModificationPotential Effect on MetabolismExpected Impact on Biofuel Production
Moderate downregulationDecreased ATP/ADP ratioShift toward overflow metabolism and increased ethanol production
Targeted mutations affecting efficiencyAltered cellular energy chargeModified fermentation product distribution
Controlled overexpressionEnhanced energy capacityImproved tolerance to metabolic stresses during fermentation

Integration with Existing Metabolic Engineering Strategies:
ATP synthase modifications could complement other metabolic engineering approaches:

  • Supporting engineered pathways that have high ATP demands

  • Enhancing sugar utilization in strains engineered for hemicellulose fermentation

  • Improving growth-independent production phases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.