Recombinant Clostridium thermocellum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cobS; Cthe_3152; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Ruminiclostridium thermocellum)
Target Names
cobS
Target Protein Sequence
MKYLKRILLMVGFLTRIPVPFKIDGTEEDYGKGLVFAPVVGLLIGGILTILFYILKRFFP PGVTGILLIAAYIMLTGGLHLDGLGDTFDGIFSNRSREKMLEIMRDSRIGTNAVLAVICV VILNYALLSSIPLSGLPKALLLFPVAGRIGSLVGAGSTVYAREGEGLGKSFINCCGIKEI LQGGIIYFIVSLLVLNIKGLLLAAATMITSFATVKFFAGKVGGATGDILGAVCELNQTFF LILFYLFK
Uniprot No.

Target Background

Function

Recombinant Clostridium thermocellum Cobalamin Synthase (CobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal growth conditions for Clostridium thermocellum for recombinant enzyme studies?

Clostridium thermocellum is a thermophilic, anaerobic, cellulolytic bacterium that grows optimally on soluble β-glucans, including cellobiose and cellulose. For laboratory cultivation, researchers typically maintain anaerobic conditions with specialized equipment while maintaining temperatures around 60-70°C. When working with recombinant strains, the adherence of C. thermocellum to cellulose substrates should be considered as it shows selective adhesion to cellulose through specific cellulose-binding factors (CBF) . For optimal enzyme activity studies, research indicates that conditions of pH 5-6 at 70°C are often ideal, though this may vary for specific recombinant constructs .

How does the cellulosome structure of C. thermocellum affect recombinant enzyme expression?

The cellulosome of C. thermocellum is a complex multi-enzyme system that includes numerous catalytic subunits. When expressing recombinant enzymes like cobS, researchers must consider potential interactions with native cellulosomal components. The CelS component, for example, demonstrates exoglucanase activities and represents the most abundant catalytic subunit of the cellulosome . Expression systems must be designed to either integrate with or function independently of the cellulosome structure. Additionally, research has shown that cellulosome synthesis is regulated by carbon catabolite repression (CCR), with cellobiose acting as a repressor . This regulatory mechanism must be considered when optimizing expression systems for recombinant enzymes.

What expression systems are most suitable for producing recombinant C. thermocellum cobS?

Based on research with other recombinant C. thermocellum enzymes, several expression systems have proven effective. E. coli-based systems can be used for initial studies, though they may lack the proper folding environment for thermophilic proteins. Homologous expression within C. thermocellum itself has advantages for proper folding and post-translational modifications. When choosing an expression system, consider that thermostability of C. thermocellum enzymes can be enhanced by factors such as Ca²⁺, as demonstrated with recombinant CelS . Expression vectors should include appropriate thermostable selection markers and inducible promoters that function at elevated temperatures required for C. thermocellum growth.

What are the key considerations for designing primers for cloning the cobS gene from C. thermocellum?

When designing primers for cobS gene amplification from C. thermocellum genomic DNA, researchers should consider the following methodological approach:

  • Analyze the GC content of the gene (C. thermocellum has a lower GC content compared to many bacteria)

  • Design primers with appropriate restriction sites for subsequent cloning

  • Consider codon optimization when expressing in heterologous systems

  • Include appropriate tags for purification and detection

  • Verify primer specificity against the C. thermocellum genome

PCR conditions should be optimized for the thermophilic nature of the template DNA, often requiring specialized polymerases and longer denaturation steps. When cloning the cobS gene, researchers should consider its role in the cobalamin synthesis pathway, which has been studied extensively in other organisms but requires specific investigation in C. thermocellum .

How can researchers optimize purification protocols for recombinant cobS from C. thermocellum?

Purification of recombinant cobS from C. thermocellum requires protocols adapted for thermostable proteins:

  • Heat treatment (60-70°C) can be used as an initial purification step to denature host proteins while retaining activity of the thermostable target protein

  • Chromatography methods should use buffers that maintain enzyme stability, often including divalent cations like Ca²⁺ that enhance thermostability

  • Include sulfhydryl-protecting agents in buffers, as research with recombinant CelS suggests sulfhydryl reagents can affect enzyme activity

  • Verify purified enzyme activity under anaerobic conditions, as oxygen exposure may affect function

  • Monitor for potential co-purification of cellulosomal components if expressing in native C. thermocellum

Researchers should implement quality control steps including SDS-PAGE analysis, western blotting, and activity assays under various conditions to confirm successful purification of functional recombinant cobS.

What analytical methods are most appropriate for assessing cobS enzymatic activity?

For analyzing recombinant cobS activity from C. thermocellum, researchers should consider:

  • HPLC or LC-MS methods to detect cobalamin intermediates and products

  • Spectrophotometric assays monitoring absorbance changes associated with cobalamin synthesis

  • Coupled enzyme assays that link cobS activity to detectable signals

  • Thermal shift assays to assess protein stability under various conditions

When establishing these assays, ensure that analytical conditions reflect the thermophilic nature of C. thermocellum enzymes. Activity measurements should be conducted at elevated temperatures (optimally around 70°C) and appropriate pH (5-6) . Additionally, researchers should account for potential interference from components in the reaction mixture, especially when working with crude extracts or partially purified samples.

How do mutations in the cobS gene affect cobalamin synthesis in C. thermocellum?

Investigating the effects of mutations in the cobS gene requires sophisticated experimental approaches:

  • Site-directed mutagenesis targeting conserved catalytic residues

  • Complementation studies in cobS-deficient strains

  • Structural analysis of mutant proteins using crystallography or modeling

  • Metabolomics analysis to track changes in cobalamin pathway intermediates

Research on cobalamin-dependent enzymes in other organisms has shown that cobalamin is a cofactor present in essential metabolic pathways, and its synthesis involves multiple enzymes including cobS . While specific mutations in C. thermocellum cobS have not been extensively characterized in the provided search results, researchers can draw parallels from studies on cobalamin synthesis in other organisms. When analyzing mutants, researchers should examine both enzymatic activity and effects on downstream metabolic pathways involving cobalamin-dependent enzymes.

How does the cobalamin synthesis pathway in C. thermocellum compare to other prokaryotic systems?

While the search results don't provide specific details about the cobalamin synthesis pathway in C. thermocellum, comparative genomics approaches can be applied:

  • Bioinformatic analysis to identify all genes involved in the cobalamin synthesis pathway in C. thermocellum

  • Comparison with well-characterized pathways in other prokaryotes

  • Expression analysis of pathway genes under various growth conditions

  • Metabolomic profiling to identify pathway intermediates

Research has shown that cobalamin is synthesized solely by prokaryotes and serves as a cofactor in essential metabolic pathways . The cobalamin pathway typically involves multiple enzymes, with cobS playing a key role in the late stages of synthesis. Researchers should consider that C. thermocellum, as a thermophilic anaerobe, may have adaptations in its cobalamin synthesis pathway compared to mesophilic organisms.

What is the relationship between cobalamin synthesis and cellulose degradation in C. thermocellum?

Investigating the potential relationship between cobalamin synthesis and cellulose degradation represents an advanced research question:

  • Comparative transcriptomics to identify co-regulated genes

  • Metabolic flux analysis to track carbon flow between pathways

  • Creation of cobS knockout strains to assess effects on cellulolytic activity

  • Proteomics analysis of cellulosome composition in cobS mutants

While the direct relationship between cobalamin synthesis and cellulose degradation in C. thermocellum has not been extensively studied according to the search results, researchers can explore potential connections. For instance, the regulation of cellulase synthesis in C. thermocellum is affected by carbon catabolite repression , and it would be valuable to investigate whether cobalamin availability influences this regulatory mechanism.

How should researchers analyze kinetic data for recombinant cobS from C. thermocellum?

Analysis of enzyme kinetic data for recombinant cobS should follow these methodological approaches:

  • Determine temperature and pH optima before conducting detailed kinetic studies

  • Use non-linear regression to fit data to appropriate enzyme kinetic models

  • Calculate and compare kinetic parameters (Km, Vmax, kcat) under various conditions

  • Consider the effects of potential activators or inhibitors

When analyzing thermophilic enzymes like those from C. thermocellum, temperature effects on reaction rates must be carefully assessed. Research with recombinant CelS has shown optimal activity at 70°C and pH 5-6, with enhanced thermostability in the presence of Ca²⁺ . Similar considerations may apply to cobS. Researchers should use appropriate statistical methods to evaluate the reliability of kinetic parameters and consider how these parameters compare to those of cobS enzymes from other organisms.

What approaches can be used to resolve discrepancies between predicted and observed concentrations in cobS activity assays?

When researchers encounter discrepancies between predicted and observed concentrations in enzyme assays, several analytical approaches can be employed:

  • Calculate and analyze the ratio of predicted to observed concentrations (Cpred/Cobs) to quantify discrepancies

  • Use non-linear mixed effects pharmacokinetic models to account for variability

  • Evaluate potential causes of systematic errors in measurements

  • Apply correction factors based on exponential decay models of the relationship between predicted and observed values

Research has shown that the ratio of predicted to observed concentrations can serve as a valuable metric for evaluating experimental results. When discrepancies are observed, researchers should assess factors such as enzyme stability, substrate depletion, product inhibition, and analytical method limitations. Statistical approaches, including minimum Euclidean distance classification criteria, can be used to categorize and interpret ratio values .

How can recombinant C. thermocellum cobS research contribute to biofuel production studies?

Research on recombinant C. thermocellum enzymes, including cobS, has potential applications in biofuel production:

  • Understanding cobS function may reveal new insights into C. thermocellum metabolism

  • Optimized recombinant enzyme production could enhance biomass conversion efficiency

  • Knowledge of cobalamin-dependent pathways may inform metabolic engineering strategies

C. thermocellum is studied extensively for its ability to degrade cellulosic biomass, making it relevant for biofuel production. The Comparison of Biofuel Cropping Systems (COBS) experiment, for example, examines biomass production and environmental impacts of different cropping systems . While this experiment does not directly involve C. thermocellum, it represents the broader research context in which studies of cellulose-degrading microorganisms are situated. Researchers investigating recombinant cobS should consider how their findings might integrate with broader biofuel research initiatives.

What methods are available for studying interactions between cobS and other enzymes in the cobalamin synthesis pathway?

Investigating enzyme-enzyme interactions in the cobalamin synthesis pathway requires specialized approaches:

  • Co-immunoprecipitation studies with tagged recombinant proteins

  • Surface plasmon resonance to measure binding kinetics

  • Cryo-electron microscopy to visualize multi-enzyme complexes

  • Fluorescence resonance energy transfer (FRET) to detect proximity in living cells

While the search results don't specifically address interactions between cobS and other enzymes, research on C. thermocellum has revealed important insights about protein-protein interactions in the cellulosome complex . Similar methodologies could be applied to study potential interactions in the cobalamin synthesis pathway. Researchers should consider that enzyme interactions may be affected by the thermophilic nature of C. thermocellum proteins and design experiments accordingly.

How can researchers overcome difficulties in expressing active recombinant cobS from C. thermocellum?

Common challenges in recombinant cobS expression and strategies to address them include:

ChallengePotential SolutionResearch Basis
Poor expression levelsOptimize codon usage for host systemGeneral recombinant protein methodology
Inclusion body formationExpress with solubility tags or chaperonesStudies on thermophilic protein expression
Loss of activityInclude appropriate cofactors in purification buffersResearch showing Ca²⁺ enhances stability of C. thermocellum enzymes
Oxygen sensitivityMaintain anaerobic conditions during purificationC. thermocellum is an anaerobic organism
Temperature sensitivityExpress at lower temperatures but purify/assay at higher temperaturesOptimal activity of C. thermocellum enzymes at 70°C

When troubleshooting expression problems, researchers should systematically test different expression hosts, vector designs, and culture conditions. For thermophilic enzymes like those from C. thermocellum, E. coli strains with enhanced ability to fold thermostable proteins may improve results. Additionally, researchers might consider cell-free expression systems that can be more readily adapted to the unique requirements of thermophilic enzymes.

What are the best approaches for confirming the identity and purity of recombinant cobS preparations?

To ensure identity and purity of recombinant cobS preparations, researchers should implement multiple complementary methods:

  • SDS-PAGE analysis to assess molecular weight and initial purity

  • Western blotting with antibodies specific to cobS or affinity tags

  • Mass spectrometry for precise molecular weight determination and peptide mapping

  • N-terminal sequencing to confirm the correct start of the protein

  • Activity assays to verify enzyme function

  • Analytical gel filtration to assess oligomeric state and homogeneity

Research on C. thermocellum proteins has demonstrated the value of combining immunological techniques with functional assays. For example, studies on the cellulose-binding factor (CBF) used antibodies and activity assays to track the protein during purification and to distinguish wild-type from mutant forms . Similar approaches can be applied to recombinant cobS, with appropriate modifications for this specific enzyme.

How might structural studies of C. thermocellum cobS inform enzyme engineering efforts?

Structural characterization of C. thermocellum cobS could advance enzyme engineering through:

  • Identification of catalytic residues and substrate binding sites

  • Comparison with cobS structures from mesophilic organisms to identify thermostability determinants

  • Rational design of mutations to enhance activity or stability

  • Computational modeling to predict effects of environmental conditions on enzyme structure

While no specific structural studies of C. thermocellum cobS are mentioned in the search results, research on other C. thermocellum enzymes has revealed important structural features. For example, studies on CelS identified a 210,000-molecular-weight polypeptide associated with cellulose binding . Structural studies of cobS could similarly identify key functional domains and inform enzyme engineering efforts aimed at enhancing activity, stability, or substrate specificity.

What emerging technologies could advance research on recombinant C. thermocellum enzymes including cobS?

Several cutting-edge technologies have potential to advance research in this area:

  • CRISPR-Cas9 genome editing for creating precise mutations in C. thermocellum

  • Single-molecule enzymology to observe cobS function in real-time

  • Nanopore sequencing for rapid analysis of genetic modifications

  • Artificial intelligence approaches for predicting enzyme properties and optimizing experimental design

  • Microfluidic systems for high-throughput enzyme assays under controlled conditions

Researchers should consider that studies of C. thermocellum enzymes benefit from approaches that can accommodate the thermophilic and anaerobic nature of this organism. Emerging technologies that allow in situ monitoring of enzyme activity at elevated temperatures would be particularly valuable for studying cobS and other C. thermocellum enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.