Recombinant Clostridium thermocellum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Overview of Lipoprotein Signal Peptidase A (LspA)

LspA, also known as type II signal peptidase (SPase II), is an enzyme that processes lipoproteins in bacteria . Lipoproteins are abundant proteins anchored to the cell membrane via a lipid moiety, serving diverse functions such as enzymes and inhibitors . LspA is essential for the intracellular growth and virulence of many bacteria .

Function and Mechanism of LspA

LspA is responsible for cleaving the signal peptide from prolipoproteins, a post-translational modification necessary for lipoprotein maturation . The enzyme functions as an aspartyl protease, utilizing two conserved aspartate residues in its active site . The mechanism involves:

  1. Abstraction of a proton from water by one aspartyl residue.

  2. Hydroxide nucleophile attacks the carbonyl carbon in the scissile peptide bond.

  3. Formation of a tetrahedral intermediate .

  4. Cleavage of the scissile bond, releasing the signal peptide and the diacylated apolipoprotein (DA-BLP) .

LspA in Clostridium thermocellum

Clostridium thermocellum is of interest in the production of biofuels . Genetic engineering of C. thermocellum to enhance its capabilities requires understanding and manipulating its enzymatic machinery, including LspA . While LspA is known to be critical in bacteria, its specific role in C. thermocellum is still being researched .

Recombinant LspA

Recombinant LspA is produced by cloning and expressing the lspA gene in a host organism, such as Escherichia coli . This allows for the production of large quantities of the enzyme for research and industrial applications. For example, the lspA gene from Rickettsia typhi has been cloned into E. coli, conferring increased globomycin resistance, which indicates its function as SPase II .

Potential Applications and Significance

  1. Drug Target: LspA has been identified as a potential target for antibacterial drug development, especially against antibiotic-resistant bacteria like methicillin-resistant Staphylococcus aureus (MRSA) . Inhibitors like globomycin and myxovirescin A bind to the active site of LspA, blocking its function .

  2. Biofuel Production: Understanding and manipulating LspA in Clostridium thermocellum may contribute to improved biofuel production through genetic engineering .

  3. Enzyme Engineering: Recombinant LspA can be used to study its structure and function, potentially leading to the engineering of enzymes with enhanced activity or specificity .

Research Findings Involving LspA

Research AreaFindings
Rickettsia typhi LspAOverexpression of R. typhi lspA in E. coli confers increased globomycin resistance, indicating its function as SPase II . Recombinant lspA from R. typhi significantly restores the growth of temperature-sensitive E. coli at nonpermissive temperatures .
LspA StructureStructures of LspA from Staphylococcus aureus complexed with globomycin and myxovirescin A1 confirm its mechanism of action as an aspartyl protease .
Conserved ResiduesLspA sequences from different bacterial species identify 14 highly conserved residues, including two strictly conserved aspartates, which are essential for its catalytic activity .
Clostridium thermocellumGenetic engineering of Clostridium thermocellum is used to enhance its capabilities in biofuel production, requiring understanding and manipulating its enzymatic machinery, including LspA .
Exoglucanase ActivityRecombinant CelS (rCelS) from Clostridium thermocellum displayed exoglucanase characteristics, including a preference for amorphous or crystalline cellulose, and the hydrolysis products from crystalline cellulose were cellobiose and cellotriose at a ratio of 5:1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
lspA; Cthe_0909; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Ruminiclostridium thermocellum)
Target Names
lspA
Target Protein Sequence
MIFIVLIAAFVAADQLTKYIVVRNIEFGDKISVIDNFFYLTHWRNTGAAWGIMQNGRYIL VPVTVVLSILIVYFIFKNSNKFYRFSLSMILGGALGNLIDRVFRTDGVVDFLDFQFGNYH FPVFNVADTFVVVGTLLLAYYTLFIYKEDKK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (LspA) and what is its function in bacteria?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that performs a critical second step in the bacterial lipoprotein processing pathway. It specifically cleaves the transmembrane helix signal peptide of lipoproteins after they have been lipidated by phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (Lgt). This processing step is essential for proper lipoprotein maturation and function . In bacterial systems, lipoproteins perform diverse crucial functions including signal transduction, stress sensing, virulence, cell division, nutrient uptake, adhesion, and triggering activation of host immune responses. Impaired lipoprotein processing directly compromises these vital functions and bacterial viability .

Why is Clostridium thermocellum LspA of particular interest to researchers?

C. thermocellum is a thermophilic, gram-positive, anaerobic bacterium known for its potent cellulose-degrading capability through the production of cellulosomes . While the search results don't specifically address C. thermocellum LspA, the enzyme is of particular interest because: (1) LspA has been identified as important for virulence in gram-positive bacteria ; (2) as a thermophilic organism, C. thermocellum's enzymes including LspA likely possess thermostable properties valuable for biotechnological applications; and (3) understanding the role of LspA in this organism could provide insights into the relationship between lipoprotein processing and cellulosome assembly, which is critical for the bacterium's ability to efficiently degrade cellulosic biomass .

How does LspA differ between gram-positive bacteria like C. thermocellum and gram-negative bacteria?

LspA serves different but critical roles in both types of bacteria. In gram-negative bacteria, LspA is essential for viability, and its absence is lethal to the cell. In contrast, for gram-positive bacteria like C. thermocellum, while not always essential for survival, LspA plays a crucial role in virulence and proper cellular function . The structural properties of LspA from different bacterial sources show high conservation in the catalytic active site, but there may be species-specific variations in the periplasmic helix and other regions that affect substrate specificity and conformational dynamics. These differences potentially reflect adaptations to the distinct cell envelope architectures of gram-positive versus gram-negative bacteria .

What are the key structural features of LspA and how do they contribute to its function?

LspA contains several important structural elements that enable its protease activity and substrate specificity. Key features include:

  • A catalytic dyad of aspartate residues in the active site that facilitates the proteolytic cleavage of the signal peptide

  • A periplasmic helix (PH) that exhibits significant conformational flexibility

  • A β-cradle structure that works with the periplasmic helix to "clamp" substrates in place

The periplasmic helix fluctuates on the nanosecond timescale, sampling multiple conformations that facilitate substrate binding and catalysis. This dynamic behavior explains how LspA can accommodate and process a variety of different lipoprotein substrates despite having a relatively specific catalytic function .

What conformational states does LspA adopt and how do they differ in the apo versus bound states?

LspA exhibits at least three distinct conformational states that reflect its functional cycle:

  • Closed conformation (dominant in apo state): The periplasmic helix positions over the active site, occluding the charged catalytic dyad from the hydrophobic membrane environment. The distance between the β-cradle and periplasmic helix is approximately 6.2 Å, completely blocking access to the active site .

  • Intermediate conformation (dominant in antibiotic-bound state): This conformation is stabilized when antibiotics like globomycin bind to LspA. It represents a state that inhibits both signal peptide cleavage and substrate binding .

  • Open conformation (transient): In this state, a trigonal cavity forms that can accommodate the lipoprotein substrate, signal peptide, and diacylglyceryl moiety. This is the only conformation that sterically allows a prolipoprotein to enter and bind to the active site for signal peptide cleavage .

LspA samples all three conformations in all states (apo, globomycin-bound, and myxovirescin-bound), but the population distribution varies significantly between states. The structural flexibility is essential for LspA's ability to bind diverse substrates and for the catalytic mechanism .

How do molecular dynamics simulations contribute to our understanding of LspA conformational dynamics?

Molecular dynamics (MD) simulations have proven invaluable for elucidating the conformational dynamics of LspA that are not fully captured by static crystal structures. These computational approaches have revealed:

  • The nanosecond timescale fluctuations of the periplasmic helix

  • The existence of conformational states not observed in crystal structures

  • The mechanistic details of how LspA transitions between closed, intermediate, and open states

  • The sterically favorable conformations for substrate binding

When combined with experimental methods like electron paramagnetic resonance (EPR), MD simulations provide a comprehensive view of LspA's functional motions. This hybrid approach has been particularly powerful, as each technique alone has limitations in visualizing the complete conformational landscape. The computational models have helped explain how LspA can occlude its charged active site from the lipid bilayer in the apo state while still allowing substrate access when needed .

What are the recommended methods for recombinant expression and purification of C. thermocellum LspA?

While the search results don't specifically describe C. thermocellum LspA expression, a modified protocol based on P. aeruginosa LspA can be adapted:

  • Cloning: Insert the C. thermocellum LspA gene into an expression vector such as pET28b with an N-terminal 6xHis tag and thrombin cleavage site

  • Expression: Transform into an appropriate E. coli expression strain

  • Purification: Employ affinity chromatography using the His-tag, followed by size exclusion chromatography

  • Detergent selection: Membrane proteins like LspA require appropriate detergents; FC12 detergent micelles have been successfully used for related LspA proteins

For C. thermocellum specifically, expression conditions would need to be optimized considering the thermophilic nature of the source organism. Temperature, pH, and buffer composition should be adjusted to maintain the protein's native conformation and activity.

What spectroscopic and biophysical methods are most effective for characterizing LspA conformational states?

Several complementary methods have proven effective for characterizing LspA:

  • Electron Paramagnetic Resonance (EPR):

    • Continuous-wave (CW) EPR for examining nanosecond timescale dynamics

    • Double Electron-Electron Resonance (DEER) for measuring distances between specific residues in different conformational states

    • Requires site-directed spin labeling at strategic residues

  • Molecular Dynamics (MD) Simulations:

    • Provides atomistic details of conformational transitions

    • Helps identify potential substrate and inhibitor binding modes

    • Can sample conformations not captured in experimental structures

  • X-ray Crystallography:

    • While challenging for membrane proteins, has been successful for antibiotic-bound forms of LspA

    • Provides high-resolution static structures that serve as starting points for dynamic studies

A hybrid approach combining these methods offers the most comprehensive characterization, as each technique has complementary strengths and limitations.

What considerations are important when designing site-directed mutagenesis experiments for C. thermocellum LspA?

When designing site-directed mutagenesis experiments for C. thermocellum LspA, researchers should consider:

  • Conservation analysis: Target highly conserved residues identified across bacterial species, particularly the catalytic dyad and the 14 additional highly conserved residues surrounding the active site

  • Thermostability factors: As C. thermocellum is thermophilic, mutations should consider maintenance of thermostability properties

  • Cysteine-free background: For EPR studies, creating a cysteine-free background before introducing specific cysteine mutations for spin labeling is recommended

  • Functional domains: Target residues in:

    • The catalytic site

    • The periplasmic helix that undergoes conformational changes

    • The β-cradle involved in substrate binding

    • Regions involved in membrane association

  • Mutagenesis methods: Protocols like PIPE Mutagenesis or QuikChange have been successfully used for LspA from other species and would likely be suitable for C. thermocellum LspA as well

How does LspA activity relate to the cellulosome system in C. thermocellum?

While the search results don't directly connect LspA to the cellulosome system, we can make informed inferences about their relationship:

C. thermocellum produces an extracellular multienzyme complex (cellulosome) that efficiently solubilizes crystalline cellulose. This complex is organized around a scaffolding protein (CipA) and interacts with cell surface anchoring proteins (OlpB, Orf2p, and SdbA) . Given that:

  • Lipoproteins function in cell adhesion and nutrient uptake in bacteria

  • The cellulosome system requires proper attachment to the cell surface

  • LspA is involved in processing lipoproteins that often serve as membrane anchors

It's reasonable to hypothesize that LspA may play a role in processing some of the lipoproteins involved in cellulosome assembly or attachment. Proper lipoprotein processing by LspA could be critical for the correct localization and functioning of cellulosome components, particularly those that interact with the cell surface or extracellular environment.

What is the significance of LspA as an antibiotic target in C. thermocellum compared to pathogenic bacteria?

The significance of LspA as an antibiotic target differs between C. thermocellum and pathogenic bacteria:

For pathogenic bacteria:

  • LspA is essential in Gram-negative bacteria, making it a lethal target

  • It's important for virulence in Gram-positive pathogens

  • The high conservation of its active site suggests that resistance mutations would likely impair the enzyme's function

  • Antibiotics like globomycin and myxovirescin have been shown to target LspA effectively

For C. thermocellum:

  • As a non-pathogenic organism primarily of interest for biofuel production, targeting its LspA would be relevant for biotechnological applications rather than medical treatments

  • Understanding LspA inhibition could provide tools to regulate C. thermocellum growth or cellulosome production in industrial applications

  • Knowledge of C. thermocellum LspA could inform the design of antibiotics against pathogenic Clostridia species

The research on LspA inhibition mechanisms is valuable across bacterial species, regardless of their pathogenicity, for understanding fundamental aspects of bacterial physiology .

How do growth conditions affect the expression and activity of LspA in C. thermocellum?

While the search results don't provide direct information about C. thermocellum LspA expression, we can draw parallels from the regulation patterns of cellulosome-related genes in C. thermocellum and LspA behavior in other bacteria:

In C. thermocellum, the expression of cellulosome components varies significantly with growth conditions:

  • Transcript levels of genes like olpB, orf2, and cipA vary with growth rate

  • Under carbon limitation at low growth rates (0.04 h⁻¹), expression reaches 40-60 transcripts per cell

  • At higher growth rates (0.35 h⁻¹), expression drops to 2-10 transcripts per cell

  • Some genes show constant expression regardless of conditions

For LspA specifically, we might expect:

  • Regulation tied to carbon source availability, as this affects cell envelope composition

  • Potential upregulation during active growth phases when new lipoproteins are needed

  • Responsiveness to temperature changes, given the thermophilic nature of C. thermocellum

  • Possible co-regulation with genes involved in cell envelope maintenance

A comprehensive analysis of LspA expression under various growth conditions would be valuable for understanding its regulation in C. thermocellum specifically.

What are the current challenges in obtaining high-resolution structures of membrane-bound LspA in different conformational states?

Obtaining high-resolution structures of membrane proteins like LspA presents several challenges:

  • Membrane environment reconstitution: Creating appropriate membrane mimetics that maintain the native conformation while enabling structural studies is technically challenging

  • Capturing transient states: The open conformation of LspA appears to be transient and may represent a minor population that is difficult to stabilize for structural studies

  • Protein dynamics: The inherent flexibility of the periplasmic helix that fluctuates on the nanosecond timescale makes it difficult to capture in static crystallographic studies

  • Thermostability concerns: For C. thermocellum LspA specifically, the thermophilic nature adds complexity to maintaining stability during purification and crystallization

  • Apo state determination: To date, only antibiotic-bound structures have been determined, while the apo and lipoprotein-bound structures remain elusive

These challenges necessitate a hybrid approach combining X-ray crystallography with solution-based methods like EPR and computational approaches like MD simulations to fully characterize the structural landscape of LspA .

How can researchers design experiments to identify the natural substrates of C. thermocellum LspA?

To identify natural substrates of C. thermocellum LspA, researchers could implement the following experimental strategies:

  • Bioinformatic prediction: Analyze the C. thermocellum genome for lipoprotein sequences containing signal peptides and lipoboxes characteristic of LspA substrates

  • Comparative proteomics:

    • Compare membrane proteomes of wild-type C. thermocellum with LspA-depleted or inhibited strains

    • Identify accumulating precursor lipoproteins that aren't properly processed

  • Substrate trapping approaches:

    • Generate catalytically inactive LspA mutants that can bind but not cleave substrates

    • Use cross-linking followed by mass spectrometry to identify trapped substrates

  • Activity assays with synthetic peptides:

    • Design fluorogenic peptide substrates based on predicted C. thermocellum lipoproteins

    • Measure cleavage efficiency to determine substrate preferences

  • In vivo validation:

    • Create reporter fusions with predicted substrate signal sequences

    • Monitor processing in the presence and absence of functional LspA

These approaches would help establish the substrate profile of C. thermocellum LspA and potentially reveal connections to the cellulosome system and other aspects of C. thermocellum physiology.

What methodological approaches can resolve contradictory data when studying LspA conformational dynamics?

When facing contradictory data about LspA conformational dynamics, researchers should consider:

  • Integration of multiple techniques:

    • Combine crystallography, EPR, and MD simulations as was done successfully in previous studies

    • Each method has limitations that the others can help overcome

  • Varied experimental conditions:

    • Test different membrane mimetics (detergents, nanodiscs, lipid bicelles)

    • Vary temperature, pH, and ionic strength to identify condition-dependent conformational preferences

  • Time-resolved measurements:

    • Employ methods that can capture dynamics at different timescales

    • CW EPR for nanosecond dynamics, DEER for longer timescale conformational distributions

  • Statistical validation:

    • Ensure sufficient sampling in both computational and experimental approaches

    • Quantify population distributions rather than just identifying individual states

  • Control experiments:

    • Use well-characterized LspA variants from other species as controls

    • Include negative controls with inactive enzyme or non-substrate peptides

The apparent contradictions often reflect the sampling of different conformational subpopulations under various conditions, as seen in the study where different conformations of LspA were observed in the apo state versus when bound to different antibiotics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.