Recombinant Clostridium thermocellum UPF0059 membrane protein Cthe_1420 (Cthe_1420)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
mntP; Cthe_1420; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Ruminiclostridium thermocellum)
Target Names
mntP
Target Protein Sequence
MSSIELLIIAVGLSMDAFAVAICKGLSMKKMSYRNAVLTGCFFGGFQALMPLLGYLLGTQ FKDYITSIDHWIAFGLLSLIGINMIKESKNTCEITDEDDTFSLKSLTVMAFATSIDALAI GVTFAFLQVNIIPAVTMIGITTFTFSFLGVKIGNLFGVKFQSKAEIVGGLILIGMGCKIL FDHLGVISFVFDSLNKFN
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0059 membrane protein Cthe_1420 and what organism does it come from?

Cthe_1420 is a membrane protein belonging to the UPF0059 family (Uncharacterized Protein Family 0059) found in Clostridium thermocellum, a thermophilic, anaerobic, cellulolytic bacterium. This organism is known for its efficient cellulose degradation capabilities and presence of various surface-associated proteins that interact with its external environment. While specific information about Cthe_1420 is limited in the current literature, it belongs to a class of membrane proteins in C. thermocellum that may play roles in cell structure, substrate recognition, or other membrane-associated functions .

What are the structural characteristics of Cthe_1420?

As a membrane protein from C. thermocellum, Cthe_1420 likely contains hydrophobic domains that anchor it within the cell membrane. While specific structural data for Cthe_1420 is not extensively documented, research on other C. thermocellum membrane proteins indicates potential structural features. Many surface proteins in this organism contain specific anchoring domains like the S-layer homology (SLH) domains, which serve to bind proteins to cell surface components such as peptidoglycan . Analysis of similar membrane proteins suggests that Cthe_1420 may contain transmembrane helices that determine its orientation and function within the membrane environment.

How is recombinant Cthe_1420 typically expressed and purified for research?

Recombinant expression of membrane proteins like Cthe_1420 typically involves creating fusion constructs similar to approaches used for other bacterial membrane proteins. A methodological approach would include:

  • Gene amplification using PCR with primers containing appropriate restriction sites

  • Cloning into expression vectors containing affinity tags (His-tag, MBP, etc.)

  • Expression in suitable host systems (E. coli, P. pastoris, or other systems depending on protein complexity)

  • Membrane fraction isolation followed by detergent solubilization

  • Purification using affinity chromatography, ion exchange, and size exclusion techniques

For thermophilic proteins like those from C. thermocellum, expression conditions often require optimization to account for potential folding issues at lower temperatures compared to the native organism's environment .

What expression systems are most effective for producing functional recombinant Cthe_1420?

The choice of expression system depends on research objectives and protein characteristics. For membrane proteins like Cthe_1420, several systems merit consideration:

Expression SystemAdvantagesDisadvantagesRecommended for Cthe_1420
E. coliFast growth, inexpensive, well-established protocolsPotential improper folding of membrane proteins, inclusion body formationInitial screening, mutational studies
Pichia pastorisPost-translational modifications, higher yields of membrane proteinsLonger expression time, more complex protocolsFunctional studies requiring glycosylation
Cell-free systemsRapid production, direct incorporation of labeled amino acidsLower yields, expensiveStructural studies requiring isotope labeling
Mammalian cellsNative-like membrane environmentExpensive, time-consumingInteraction studies with eukaryotic partners

Based on successful expression strategies for other bacterial membrane proteins, a methodological approach would begin with the construction of a codon-optimized gene sequence for the selected expression host. For E. coli expression, vectors containing fusion partners that enhance solubility (such as MBP or SUMO) often improve yields. If expression in E. coli yields non-functional protein, yeast systems like P. pastoris have shown success for membrane proteins as demonstrated with other recombinant proteins .

What detergents and buffer conditions are optimal for Cthe_1420 solubilization and stability?

The selection of detergents and buffer conditions is critical for maintaining membrane protein stability and function after extraction from membranes. A methodological approach to optimizing conditions for Cthe_1420 would include:

  • Screen multiple detergents starting with mild non-ionic options (DDM, LMNG, Digitonin)

  • Test buffer compositions varying pH (typically 6.5-8.0), salt concentrations (100-500 mM NaCl), and stabilizing additives (glycerol 5-10%)

  • Evaluate protein stability using techniques such as size exclusion chromatography, thermal shift assays, and activity measurements over time

For thermophilic membrane proteins like Cthe_1420, higher temperatures (30-40°C) during purification may improve stability compared to standard cold-room conditions. Consider buffer components that mimic the native cellular environment of C. thermocellum, which thrives in anaerobic conditions at elevated temperatures .

How can researchers determine if recombinant Cthe_1420 retains its native conformation?

Assessing whether recombinant Cthe_1420 maintains its native structure requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

  • Thermal stability assays to compare melting temperatures with values expected for thermophilic proteins

  • Limited proteolysis patterns compared between native and recombinant forms

  • Functional assays based on predicted protein activities or binding partners

  • Antibody recognition if antibodies against the native protein are available

For membrane proteins, reconstitution into lipid nanodiscs or liposomes can provide a more native-like environment for structural and functional assessment than detergent micelles alone. This approach may be particularly useful for thermophilic membrane proteins that evolved in specialized membrane compositions .

What techniques are most suitable for studying Cthe_1420 interactions with other cellular components?

Understanding membrane protein interactions requires specialized techniques that preserve native interactions while providing measurable outputs. For Cthe_1420, consider:

  • Pull-down assays: Using tagged recombinant Cthe_1420 to identify binding partners from cell lysates. This would involve immobilizing purified Cthe_1420 on an affinity resin, passing cellular extracts over the column, and identifying interacting proteins by mass spectrometry.

  • Surface Plasmon Resonance (SPR): For quantitative binding measurements between Cthe_1420 and potential partners, with calculation of association/dissociation kinetics.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify nearby proteins in the native membrane environment.

  • Microscale Thermophoresis (MST): To measure interactions in solution with minimal protein consumption.

  • High-speed Atomic Force Microscopy: To directly visualize protein dynamics and interactions within membrane environments, similar to approaches used for other membrane proteins .

For studying potential interactions with peptidoglycan or other cell wall components, chimeric protein approaches similar to those used for studying SLH domains could be adapted. This would involve creating fusion proteins between portions of Cthe_1420 and reporter proteins to test binding to cell wall fractions .

What role might Cthe_1420 play in C. thermocellum membrane organization and function?

While specific functions of Cthe_1420 require experimental determination, examining membrane protein function in C. thermocellum provides context for potential roles:

  • Structural organization: Similar to S-layer proteins, Cthe_1420 might contribute to cell envelope integrity or surface architecture.

  • Transport function: As a membrane protein, it may participate in solute transport across the membrane.

  • Signaling: Potential involvement in sensing environmental conditions relevant to C. thermocellum's ecological niche.

  • Cellulosome association: Given C. thermocellum's specialized cellulose degradation machinery, Cthe_1420 might interface with cellulosome components.

Research approaches to determine function could include gene knockout studies to observe phenotypic changes, localization studies using fluorescent protein fusions or immunolabeling, and comparative genomics with related proteins from other species .

How can cryo-EM be optimized for structural determination of Cthe_1420?

Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology. A methodological approach for Cthe_1420 would include:

  • Sample preparation optimization:

    • Screening detergents and amphipols that maintain protein stability while providing contrast

    • Testing different grid types and glow discharge parameters

    • Optimizing protein concentration (typically 2-5 mg/ml)

  • Data collection strategy:

    • Collection of multiple datasets with varying defocus values

    • Use of energy filters to improve signal-to-noise ratio

    • Implementation of beam-tilt series for aberration correction

  • Data processing workflow:

    • Particle picking strategies tailored to membrane proteins in micelles

    • 2D classification to identify homogeneous populations

    • 3D classification to separate conformational states

    • Focused refinement of flexible domains

For smaller membrane proteins like Cthe_1420, recent advances in micro-ED (electron diffraction) might provide an alternative if the protein can be crystallized, even with microcrystals too small for traditional X-ray crystallography .

How can researchers overcome aggregation issues during Cthe_1420 purification?

Membrane protein aggregation remains a significant challenge in recombinant protein production. For Cthe_1420, consider these methodological solutions:

  • Expression optimization:

    • Reduce expression temperature to slow protein synthesis

    • Use tightly controlled inducible promoters to prevent overwhelming the membrane insertion machinery

    • Co-express with chaperones specific for membrane proteins

  • Solubilization strategies:

    • Screen detergent mixtures rather than single detergents

    • Implement stepwise solubilization protocols with increasing detergent concentrations

    • Consider novel solubilization agents like SMALPs (styrene maleic acid lipid particles)

  • Purification approach:

    • Include stabilizing additives (glycerol, specific lipids, osmolytes)

    • Perform size exclusion chromatography as the final purification step to remove aggregates

    • Consider on-column refolding for proteins recovered from inclusion bodies

  • Quality control:

    • Implement dynamic light scattering to monitor aggregation state

    • Use fluorescence-detection size exclusion chromatography (FSEC) to track protein quality throughout purification

For thermophilic proteins like Cthe_1420, purification at elevated temperatures (30-45°C) may paradoxically reduce aggregation by promoting proper folding .

What strategies can address the limited structural data available for UPF0059 family proteins like Cthe_1420?

When working with poorly characterized protein families like UPF0059, researchers can employ several approaches to gain structural insights:

  • Homology modeling:

    • Identify distant homologs with solved structures through sensitive sequence alignment tools (HHpred, AlphaFold)

    • Build preliminary models based on structural homologs

    • Validate models through experimental approaches like disulfide mapping or chemical crosslinking

  • Integrative structural biology:

    • Combine lower-resolution techniques (SAXS, negative stain EM) with computational modeling

    • Use hydrogen-deuterium exchange mass spectrometry to identify exposed regions

    • Apply distance constraints from FRET or EPR spectroscopy to refine models

  • Divide-and-conquer approach:

    • Express and determine structures of individual domains

    • Use truncation constructs to identify stable, well-behaved protein fragments

    • Reconstitute full structural understanding from domain structures and their orientations

  • AlphaFold2 and other AI-based prediction tools:

    • Generate preliminary structural models even with limited sequence homology

    • Use these models to guide experimental design and interpretation

These approaches can provide valuable structural insights while experimental methods for the full-length protein are being optimized .

How can researchers distinguish between specific and non-specific interactions when studying Cthe_1420 binding partners?

Distinguishing genuine interaction partners from non-specific associations is particularly challenging for membrane proteins due to their hydrophobic surfaces. Methodological solutions include:

For membrane proteins like Cthe_1420, developing binding assays that account for the membrane environment is crucial, as demonstrated in studies of membrane-mediated protein interactions that revealed energy landscapes with specific attractive and repulsive regions .

How should researchers interpret conflicting data about Cthe_1420 function or structure?

When faced with conflicting experimental results regarding Cthe_1420, a systematic approach to data interpretation is essential:

  • Methodological assessment:

    • Evaluate differences in experimental conditions (detergents, buffers, temperature)

    • Consider protein preparation methods and potential for different conformational states

    • Assess sensitivity and specificity of different techniques

  • Reconciliation strategies:

    • Determine if different results represent distinct functional states rather than contradictions

    • Consider allosteric effects or post-translational modifications

    • Evaluate if membrane composition affects protein behavior

  • Replication with controls:

    • Repeat key experiments with appropriate internal controls

    • Validate findings using multiple independent techniques

    • Consider collaborative verification through different laboratories

  • Computational validation:

    • Use molecular dynamics simulations to test structural stability under different conditions

    • Evaluate if different proposed structures represent energy minima in the conformational landscape

Membrane proteins often exist in multiple conformational states, and apparently conflicting data may simply capture different states of a dynamic system, as observed in studies of membrane protein dimers that temporarily dissociate and reassociate .

What bioinformatic approaches can predict Cthe_1420 function based on sequence conservation?

When experimental data is limited, computational approaches can provide functional hypotheses for proteins like Cthe_1420:

  • Sequence-based analyses:

    • Multiple sequence alignment of UPF0059 family members to identify conserved residues

    • Analysis of co-evolving residues to predict functional sites

    • Examination of genomic context and gene neighborhood

  • Structural prediction integration:

    • Mapping conserved residues onto predicted structural models

    • Identification of potential binding pockets or catalytic sites

    • Comparison with structural databases to identify similar folds with known functions

  • Systems biology approaches:

    • Analysis of gene expression correlation with known functional pathways

    • Protein-protein interaction network prediction

    • Metabolic context analysis in C. thermocellum

  • Evolutionary analysis:

    • Phylogenetic profiling to correlate presence/absence with specific phenotypes

    • Analysis of selection pressure on different protein regions

    • Horizontal gene transfer assessment

This integrative bioinformatic approach can generate testable hypotheses about protein function, particularly valuable for UPF0059 family proteins with limited experimental characterization .

How can researchers develop standardized assays to measure Cthe_1420 activity?

Developing activity assays for poorly characterized proteins requires a methodical approach:

  • Function prediction-based assays:

    • Design assays based on predicted functional categories (binding, enzymatic, structural)

    • Test for activities common in the protein family or suggested by structural features

    • Examine potential roles in membrane organization or integrity

  • Binding assay development:

    • Screen interactions with membrane components, peptidoglycan, or other cell envelope elements

    • Develop fluorescence-based or FRET assays for real-time interaction monitoring

    • Consider thermal shift assays to detect ligand-induced stabilization

  • Functional complementation:

    • Express Cthe_1420 in heterologous systems with knockout of similar proteins

    • Assess ability to restore wild-type phenotypes

    • Use chimeric proteins to map functional domains

  • In vivo activity correlation:

    • Monitor changes in protein localization, modification, or abundance in response to environmental conditions

    • Develop reporter systems fused to potential regulatory elements

    • Correlate expression patterns with specific cellular functions

For membrane proteins, reconstitution into liposomes can provide a controlled environment to assess functions like ion transport, substrate binding, or effects on membrane properties such as fluidity or curvature .

What are the most promising future research directions for understanding Cthe_1420?

Based on current knowledge of C. thermocellum membrane proteins and UPF0059 family members, several research directions hold particular promise:

  • Structural biology integration:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Compare experimental structures with computational predictions

    • Analyze structural dynamics through hydrogen-deuterium exchange or molecular dynamics

  • Functional characterization:

    • Generate knockout mutants to determine phenotypic effects

    • Perform proteome-wide interaction studies to identify binding partners

    • Investigate potential roles in cell envelope maintenance, particularly under stress conditions

  • Comparative biology:

    • Examine UPF0059 family members across bacterial species

    • Investigate conservation patterns in thermophiles versus mesophiles

    • Determine if function is conserved across phylogenetically diverse bacteria

  • Biotechnological applications:

    • Evaluate potential for enzyme immobilization or surface display

    • Investigate thermostability determinants for protein engineering

    • Consider applications in synthetic biology or biofilm engineering

The integration of advanced structural methods with functional genomics and detailed biochemical characterization represents the most comprehensive approach to unraveling the role of this uncharacterized protein family .

How might understanding Cthe_1420 contribute to broader knowledge of bacterial membrane biology?

Research on Cthe_1420 has potential to advance several areas of bacterial membrane biology:

  • Thermophilic adaptation mechanisms:

    • Reveal how membrane proteins maintain stability at elevated temperatures

    • Identify structural features that confer thermostability

    • Understand membrane composition-protein interaction in thermophiles

  • Membrane protein evolution:

    • Provide insights into the evolution of UPF0059 family across bacterial phyla

    • Identify conserved structural elements despite sequence divergence

    • Understand adaptation of membrane proteins to different cellular envelopes

  • Protein-membrane interactions:

    • Contribute to understanding how proteins like Cthe_1420 interact with the membrane bilayer

    • Characterize energy landscapes of membrane-mediated protein interactions

    • Develop models for membrane protein diffusion and association

  • Cellulosome-associated functions:

    • Explore potential links between membrane proteins and the cellulosome complex

    • Investigate membrane anchoring of extracellular enzymatic machinery

    • Understand the role of membrane organization in cellulose degradation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.