Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213)

Shipped with Ice Packs
In Stock

Description

Introduction to Cthe_2213 and Clostridium thermocellum

Clostridium thermocellum (recently also referred to as Acetivibrio thermocellum, Ruminiclostridium thermocellum, or Hungateiclostridium thermocellum) is a Gram-positive, anaerobic, thermophilic bacterium that has garnered significant research interest for its exceptional capacity to degrade cellulosic materials . This organism has emerged as a promising candidate for consolidated bioprocessing (CBP) in cellulosic biofuel production due to its ability to both solubilize cellulose and ferment it to produce ethanol in a single step .

C. thermocellum degrades cellulose through a complex multi-enzyme system called the cellulosome, which displays remarkable efficiency in breaking down crystalline cellulose . The bacterium's genome has been sequenced, revealing numerous genes involved in cellulose degradation, stress response, and cellular metabolism .

Among the proteins identified in C. thermocellum is Cthe_2213, classified as a UPF0316 (Uncharacterized Protein Family 0316) protein. This designation indicates that while the protein's sequence and structure may be known, its precise biological function remains inadequately characterized. The protein is encoded by the gene Cthe_2213, located on chromosome NC_009012.1 (positions 2641996..2642613, complement) .

Production and Recombinant Expression

The recombinant production of Cthe_2213 protein is typically achieved using various expression systems, including E. coli, yeast, baculovirus, or mammalian cells . The choice of expression system may depend on specific research requirements such as protein folding, post-translational modifications, or yield optimization.

Commercially available recombinant Cthe_2213 is generally produced with N-terminal and/or C-terminal tags to facilitate purification and detection . These tags may include His-tags, GST, or other fusion partners. The specific tag configurations are often determined during the manufacturing process based on tag-protein stability considerations .

The protein is typically purified to ≥85% purity as determined by SDS-PAGE and may be supplied in either lyophilized or liquid formulations depending on stability and storage requirements . For extended storage, the protein is recommended to be kept at -20°C or -80°C to maintain activity and structural integrity .

Potential Biological Function and Role

As a membrane protein in C. thermocellum, Cthe_2213 may potentially be involved in one or more of the following functions:

  1. Membrane Transport: It may participate in the transport of substrates, metabolites, or ions across the cell membrane, which would be essential for nutrient acquisition or waste export.

  2. Environmental Sensing: Given C. thermocellum's ability to detect and respond to cellulosic substrates, Cthe_2213 might function in sensing extracellular conditions or specific carbohydrates.

  3. Signal Transduction: The protein could be involved in transmitting signals from the environment to the cell's interior, potentially as part of regulatory pathways controlling cellulosome expression or stress responses.

  4. Stress Response: C. thermocellum must adapt to various environmental stresses, including heat and chemical inhibitors. Cthe_2213 might play a role in these responses, as indicated by its presence in the bacterium that shows remarkable tolerance to various stresses .

  5. Cellulosome-Related Functions: While not directly identified as a cellulosomal component, Cthe_2213 might indirectly support cellulosome function through regulatory mechanisms, membrane organization, or other supportive roles.

Research by Yang et al. (2022) investigated the structure of the C. thermocellum RsgI9 ectodomain, which is involved in cellulose sensing and gene expression regulation via anti-σ factors . While Cthe_2213 is not specifically mentioned in this context, similar membrane proteins in C. thermocellum have been shown to participate in carbohydrate sensing and regulatory networks.

Applications and Research Significance

The study of Cthe_2213 and similar proteins from C. thermocellum holds significant importance for several research areas and potential applications:

  1. Biofuel Production: Understanding all components involved in C. thermocellum's cellulose metabolism could contribute to optimizing this organism for consolidated bioprocessing of lignocellulosic biomass to produce biofuels .

  2. Protein Structure-Function Relationships: Characterizing the structure and function of UPF0316 family proteins contributes to our broader understanding of protein evolution and membrane protein biology.

  3. Stress Response Mechanisms: Research into how C. thermocellum adapts to environmental stresses, potentially involving Cthe_2213, could provide insights applicable to industrial fermentation processes .

  4. Synthetic Biology Applications: Detailed knowledge of membrane proteins like Cthe_2213 might enable the engineering of synthetic cellular systems with enhanced capabilities for substrate utilization or product formation.

  5. Vaccine Development: Recombinant proteins from C. thermocellum, including potentially Cthe_2213, have been explored for vaccine development applications, although it is noted that these products are strictly for research purposes and cannot be used directly on humans or animals .

References Creative Biolabs. Recombinant Clostridium Thermocellum Cthe_2213 Protein (aa 1-205). ChemicalBook. Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213) information. Phys.org. Study reveals role of β-glucosidase in oligosaccharide metabolism of Clostridium thermocellum. MyBioSource. UPF0316 protein Cthe_2213 (Cthe_2213), Recombinant Protein. PubMed. The structure of the Clostridium thermocellum RsgI9 ectodomain. PMC. Form and Function of Clostridium thermocellum Biofilms. PMC. In Vitro Reconstitution of the Complete Clostridium thermocellum Cellulosome. PubMed. Structure of the Clostridium thermocellum gene licB. OSTI. Ethanol tolerance in engineered strains of Clostridium thermocellum. PubMed. Insight into the autoproteolysis mechanism of the RsgI9 anti-σ factor from Clostridium thermocellum. University of Tennessee. Endogenous Carbohydrate Esterases of Clostridium Thermocellum. Wilson et al. Clostridium thermocellum transcriptomic profiles after exposure to furfural or heat stress. Gene Biosystems. Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213). Wikipedia. Acetivibrio thermocellum. PubMed. The role of AdhE on ethanol tolerance and production in Clostridium thermocellum. ChemicalBook. Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213). Europe PMC. Culture by Clostridium thermocellum. BioResources. Consolidated bioprocessing using Clostridium thermocellum and Thermoanaerobacterium thermosaccharolyticum co-culture for enhancing ethanol production from corn straw.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cthe_2213; UPF0316 protein Cthe_2213
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Ruminiclostridium thermocellum)
Target Names
Cthe_2213
Target Protein Sequence
MEGIVNSGLFNWLILPLLIFFSRIIDVTIGTIRIIFVSRGKKYLAPVLGFFEVLVWIMAI SQIMQNLNNFVCYFAYAAGFATGTFVGIIIEEKLAIGTLVIRVIVDKNECELKERLSKSG FGVTVVDAKGKNGDVKIIYTIIKRKELQEVVRIIEECNSKAFYSIEDARKVNQGIFRTGT SNHDGTRFFNLFRIHRMSGLDKKTR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Clostridium thermocellum and why is it significant for research?

Clostridium thermocellum (also referred to as Acetivibrio thermocellum, Ruminiclostridium thermocellum, or Hungateiclostridium thermocellum) is a Gram-positive, anaerobic, thermophilic bacterium that has attracted substantial research interest due to its exceptional capacity to degrade cellulosic materials. The organism has emerged as a promising candidate for consolidated bioprocessing (CBP) in cellulosic biofuel production because of its unique ability to both solubilize cellulose and ferment it to produce ethanol in a single step.

The bacterium's genome has been fully sequenced, revealing numerous genes involved in cellulose degradation, stress response, and cellular metabolism. Most notably, C. thermocellum degrades cellulose through a complex multi-enzyme system called the cellulosome, which displays remarkable efficiency in breaking down crystalline cellulose. This system represents one of the most efficient natural cellulose-degrading mechanisms known, making it valuable for both fundamental research and biotechnological applications.

What is the UPF0316 protein family and how is Cthe_2213 characterized genomically?

The UPF0316 designation (Uncharacterized Protein Family 0316) indicates that while the protein's sequence and structure may be known, its precise biological function remains inadequately characterized. Cthe_2213 belongs to this family of proteins with unknown functions, representing an opportunity for novel functional discoveries.

Genomically, the protein is encoded by the gene Cthe_2213, located on chromosome NC_009012.1 at positions 2641996..2642613 on the complement strand. This genomic context can provide initial clues about potential functions through analysis of neighboring genes or operonic structures. While the primary sequence is known, structure-function relationships remain largely unexplored, creating significant research potential.

What expression systems are most effective for recombinant Cthe_2213 production?

The recombinant production of Cthe_2213 protein can be achieved using various expression systems, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, rapid growth, simple media requirementsLimited post-translational modifications, potential inclusion body formationInitial characterization, structural studies
Yeast (S. cerevisiae, P. pastoris)Eukaryotic PTMs, secretion capacityLonger cultivation time, hyperglycosylationFunctional studies requiring some PTMs
Baculovirus-insect cellsComplex eukaryotic PTMs, proper foldingTechnical complexity, higher costStudies requiring authentic protein folding
Mammalian cells (CHO, HEK293)Full range of human-like PTMsHighest cost, complex media, slower growthFunctional studies requiring authentic PTMs

The choice of expression system depends on specific research requirements such as protein folding needs, post-translational modifications, or yield optimization . For initial characterization studies of Cthe_2213, E. coli systems often provide sufficient yield, while more complex functional studies might benefit from eukaryotic expression systems.

How can codon optimization enhance recombinant Cthe_2213 expression?

Codon optimization represents a powerful strategy for improving recombinant protein expression. For thermophilic bacterial proteins like Cthe_2213, codon bias between the source organism and expression host can significantly impact expression efficiency:

Codon optimization strategies should consider:

  • Matching codon usage to the expression host's preferred codons

  • Optimizing GC content, particularly at the third position of each codon

  • Avoiding rare codons that may cause ribosomal pausing

  • Eliminating sequence elements that might form secondary structures in mRNA

Studies have demonstrated that codon optimization can increase recombinant protein expression levels by up to 2.8-fold in CHO cells . For thermophilic bacterial proteins like Cthe_2213, addressing the GC content difference between the native organism and the expression host is particularly important, as thermophiles typically have higher GC content to stabilize DNA at elevated temperatures.

The relationship between tRNA abundance and translation efficiency is critical - codons associated with low-frequency tRNAs translate more slowly and potentially less accurately. Optimizing for codons with higher tRNA abundance in the expression host can therefore enhance both translation rate and accuracy .

What purification strategies yield the highest purity of recombinant Cthe_2213?

Purification of recombinant Cthe_2213 typically involves affinity chromatography using N-terminal and/or C-terminal tags. Commercially available recombinant Cthe_2213 is generally produced with tags such as His-tags or GST to facilitate purification and detection.

A suggested purification protocol includes:

  • Initial clarification: Centrifugation of cell lysate at 12,000g for 30 minutes followed by filtration through a 0.45μm membrane

  • Affinity chromatography: For His-tagged Cthe_2213, using Ni-NTA resin with imidazole gradient elution (20-250mM)

  • Secondary purification: Size exclusion chromatography using Superdex 75 or 200 columns to remove aggregates and impurities

  • Quality control: SDS-PAGE analysis to confirm ≥85% purity, Western blotting to verify identity, and dynamic light scattering to assess aggregation state

The specific tag configurations are determined during the manufacturing process based on tag-protein stability considerations. For research requiring tag removal, incorporating a precision protease cleavage site between the tag and protein allows post-purification tag removal.

What computational approaches can predict structure-function relationships for Cthe_2213?

Given the uncharacterized nature of Cthe_2213, computational approaches offer valuable initial insights into potential functions:

  • Homology modeling: Using structure prediction tools like AlphaFold2 or SWISS-MODEL to generate 3D structural models based on homologous proteins

  • Molecular dynamics simulations: Analyzing the stability and conformational changes of predicted structures

  • Binding site prediction: Tools like CASTp or SiteMap can identify potential active sites or binding pockets

  • Integrative genomics: Analyzing gene neighborhood, co-expression data, and phylogenetic profiles to predict functional associations

For UPF0316 family proteins like Cthe_2213, structure-based function prediction may be particularly valuable since sequence conservation might be limited. Full-length protein structural analysis provides detailed information about the three-dimensional architecture, which is crucial for understanding potential functions and designing targeted experiments .

What experimental approaches can determine the biological function of Cthe_2213?

A systematic experimental workflow to elucidate the function of Cthe_2213 could include:

  • Expression profile analysis: Determining when and under what conditions Cthe_2213 is expressed in C. thermocellum

  • Protein-protein interaction studies:

    • Pull-down assays with tagged Cthe_2213

    • Crosslinking mass spectrometry to identify interaction partners

    • Two-hybrid screening to map the interaction network

  • Genetic approaches:

    • CRISPR-Cas9 gene knockout or knockdown to observe phenotypic effects

    • Complementation studies in knockout strains

  • Biochemical characterization:

    • Substrate screening assays to identify potential enzymatic activities

    • Binding assays with cellulosome components and cellulosic substrates

    • Structural studies using X-ray crystallography or cryo-EM

These approaches should be conducted under conditions that mimic the native environment of C. thermocellum, including anaerobic conditions and elevated temperatures (55-60°C), to ensure physiological relevance.

How might Cthe_2213 contribute to the cellulosome complex functionality?

While Cthe_2213 is not currently characterized as a known cellulosome component, investigating its potential role in this complex could yield important insights:

The cellulosome represents a sophisticated multi-enzyme complex that efficiently degrades crystalline cellulose. Exploring whether Cthe_2213 interacts with established cellulosome components could reveal auxiliary or regulatory functions. Research approaches might include:

  • Domain architecture analysis: Examining whether Cthe_2213 contains dockerin domains that could facilitate integration into the cellulosome

  • Co-purification studies: Determining if Cthe_2213 co-purifies with cellulosome fractions under native conditions

  • Crosslinking mass spectrometry: Identifying potential interactions with scaffoldin or other cellulosome components

  • Activity assays: Testing whether addition of purified Cthe_2213 enhances cellulosome activity on different substrates

Understanding potential structural or functional contributions of uncharacterized proteins like Cthe_2213 to the cellulosome could provide opportunities for engineering enhanced cellulose degradation systems.

How can site-directed mutagenesis help elucidate the function of Cthe_2213?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in uncharacterized proteins like Cthe_2213:

  • Conservation-guided mutagenesis: Target residues conserved across UPF0316 family members

  • Structure-based mutagenesis: Once a structural model is available, focus on:

    • Predicted active site residues

    • Surface-exposed patches that might mediate protein-protein interactions

    • Residues in predicted binding pockets

  • Alanine-scanning mutagenesis: Systematic replacement of residues with alanine to identify functional hotspots

For each mutant, comparative analysis should include:

  • Expression and stability assessment

  • Structural integrity evaluation (circular dichroism or thermal shift assays)

  • Functional assays based on hypothesized activities

  • Interaction studies with potential binding partners

This systematic approach can identify critical residues that, when mutated, alter function or abolish activity, thereby providing mechanistic insights into Cthe_2213's biological role.

What strategies overcome common expression challenges for thermophilic proteins like Cthe_2213?

Expressing thermophilic proteins in mesophilic hosts presents unique challenges that require specific optimization strategies:

ChallengeUnderlying CauseSolution Strategy
Poor solubilityHydrophobic interactions optimized for thermophilic conditionsLower expression temperature (16-20°C), add solubility-enhancing fusion tags (SUMO, MBP)
Improper foldingChaperone systems differ between thermophiles and mesophilesCo-express thermophilic chaperones, use specialized E. coli strains (Arctic Express)
Low expressionCodon bias, mRNA stability issuesCodon optimization, optimize GC content, remove rare codons
Protein aggregationExposed hydrophobic patches stabilized at high temperaturesAdd stabilizing agents (osmolytes, specific ions), engineer surface residues
Proteolytic degradationRecognition by host proteasesAdd protease inhibitors, use protease-deficient strains

When expressing Cthe_2213, it's important to remember that while C. thermocellum is thermophilic (optimal growth around 60°C), most expression hosts operate at much lower temperatures. This temperature mismatch can affect protein folding and stability . Transcription factors such as ZFP-TF, ATF4, or GADD34 have been shown to significantly increase recombinant protein yields by up to 10-fold when overexpressed in host cells .

How can protein stability and activity of purified Cthe_2213 be maintained during storage and analysis?

Maintaining the stability and activity of thermophilic proteins during storage and analysis requires specific conditions:

  • Buffer optimization:

    • Test stability in various buffers (phosphate, HEPES, Tris) at pH ranges (6.0-8.0)

    • Include stabilizing agents (glycerol 10-20%, trehalose 100-200mM)

    • Add reducing agents if cysteine residues are present (DTT, β-mercaptoethanol)

  • Storage conditions:

    • Short-term: 4°C with preservatives (sodium azide 0.02%)

    • Medium-term: -20°C in buffer containing 50% glycerol

    • Long-term: Flash-freeze aliquots in liquid nitrogen and store at -80°C

  • Stability assessment:

    • Regular SDS-PAGE analysis to monitor degradation

    • Thermal shift assays to assess folding status

    • Activity measurements (if known) to confirm functional integrity

  • Working temperature considerations:

    • Consider performing functional assays at elevated temperatures (40-60°C) to match the protein's natural environment

    • For structural studies, stability at room temperature should be verified

Properly maintaining protein stability is crucial for obtaining reliable experimental results, particularly for proteins like Cthe_2213 where the native function remains to be characterized.

How can transcriptomics and proteomics approaches advance understanding of Cthe_2213 function?

Integrative omics approaches offer powerful means to contextualize the function of uncharacterized proteins like Cthe_2213:

  • Transcriptomic analysis:

    • RNA-seq to determine co-expression patterns with known genes

    • Expression profiling under various growth conditions (different carbon sources, stress conditions)

    • Differential expression analysis comparing wild-type and Cthe_2213 knockout strains

  • Proteomic approaches:

    • Quantitative proteomics to identify proteins with correlated abundance profiles

    • Phosphoproteomics to identify potential post-translational modifications

    • Protein-protein interaction mapping through affinity purification-mass spectrometry

  • Metabolomic integration:

    • Targeted metabolite analysis in Cthe_2213 knockout vs. wild-type strains

    • Flux analysis to identify metabolic pathways potentially affected by Cthe_2213

  • Systems biology integration:

    • Network analysis to position Cthe_2213 within cellular pathways

    • Machine learning approaches to predict function from integrated omics data

These approaches can provide contextual information about when and where Cthe_2213 functions, potentially revealing its role in cellulose metabolism or other cellular processes in C. thermocellum.

What emerging technologies could accelerate functional characterization of proteins like Cthe_2213?

Several cutting-edge technologies hold promise for accelerating the functional characterization of uncharacterized proteins:

  • Cryo-electron microscopy:

    • Near-atomic resolution structures without crystallization

    • Visualization of protein complexes in near-native states

  • AlphaFold2 and structure prediction:

    • Accurate structural models even for proteins with limited homology

    • Structure-based function prediction and active site identification

  • High-throughput substrate screening:

    • Microfluidics-based approaches for testing thousands of potential substrates

    • Activity-based protein profiling to identify enzyme-substrate interactions

  • Single-molecule approaches:

    • FRET-based assays to monitor conformational changes upon substrate binding

    • Optical tweezers to study mechanical properties relevant to cellulosome function

  • CRISPR-based technologies:

    • CRISPRi for fine-tuned gene regulation to study dosage effects

    • CRISPR screens to identify genetic interactions with Cthe_2213

By combining these technologies with traditional biochemical and genetic approaches, researchers can accelerate the functional characterization of Cthe_2213 and other uncharacterized proteins in the C. thermocellum genome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.