Recombinant Clostridium thermocellum UPF0365 protein Cthe_0858 (Cthe_0858)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Clostridium thermocellum UPF0365 Protein Cthe_0858 (Cthe_0858)

Recombinant Clostridium thermocellum UPF0365 protein Cthe_0858 (Cthe_0858) is a protein derived from the bacterium Clostridium thermocellum . It is produced using recombinant DNA technology, where the gene encoding the protein is inserted into a host organism (e.g., E. coli) to facilitate its expression and purification .

Basic Information

FeatureDescription
Protein NameUPF0365 protein Cthe_0858
Gene NameCthe_0858
Source OrganismClostridium thermocellum (strain ATCC 27405 / DSM 1237)
UniProt IDA3DDR3
Protein LengthFull Length (1-329 amino acids)
TagHis-tagged
PurityGreater than 90% as determined by SDS-PAGE
SynonymsfloA; Cthe_0858; Flotillin-like protein FloA

Production and Quality Control

Clostridium thermocellum UPF0365 protein Cthe_0858 is produced in E. coli and tagged with an N-terminal His-tag to facilitate purification . The purity of the recombinant protein is typically greater than 90%, as determined by SDS-PAGE .

Potential Applications and Research Directions

While specific functional studies on Cthe_0858 may be limited, its identification and production as a recombinant protein suggest potential applications in various research areas:

  • Structural Biology: Recombinant Cthe_0858 can be used for structural studies to determine its 3D structure, providing insights into its potential function .

  • Enzyme Assays: If Cthe_0858 possesses enzymatic activity, it can be used in enzyme assays to study its kinetics and substrate specificity .

  • Protein-Protein Interactions: Recombinant Cthe_0858 can be utilized in interaction studies to identify its binding partners and elucidate its role in cellular processes .

  • Biotechnological Applications: Depending on its function, Cthe_0858 may have applications in various biotechnological processes, such as biofuel production or biotransformation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; Cthe_0858; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Ruminiclostridium thermocellum)
Target Names
Cthe_0858
Target Protein Sequence
MDGIAFILIVGAILVFISLFFAIVPVGLWISAFAANVRVSIFTLIGMRLRRVVPSRVINP LIKATKAGINVSINKLEAHYLAGGNVDRVVNALIAAQRANIPLEFERAAAIDLAGRNVLE AVQMSVNPKVIETPVVAAIAKDGIELRAKARVTVRANIDRLVGGAGEQTIIARVGEGVVT TVGSATDHKQVLENPDAISKTVLSKGLDAGTAFEILSIDIADIDVGRNVGAQLQTDQAEA DKRIAQAKAEERRAMAVAREQEMKAMVQEMRAKVVEAEAEVPKALAAALREGKIGVLDYY HLQNLIADTQMRDSISKMSKHDDSSSDKK
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered crucial regulators of membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is Cthe_0858 and how was it initially identified?

Cthe_0858 is a hypothetical protein from Clostridium thermocellum that was detected during membrane protein complex analysis using Blue Native-PAGE (BN-PAGE) techniques. It was identified as one of three hypothetical proteins (along with Cthe_2693 and Cthe_2709) present in membrane samples . The protein shows weak similarity to several domains including PRK 13665, pfam 12127, and COG4864, though the specific functions of these domains remain unknown . The identification of this protein in membrane fractions suggests it may play a role in membrane-associated processes, though its precise function requires further characterization.

How does Cthe_0858 compare to other hypothetical proteins detected in C. thermocellum membrane samples?

Among the three hypothetical proteins detected in C. thermocellum membrane samples (Cthe_0858, Cthe_2693, and Cthe_2709), Cthe_0858 is distinguished by its weak similarity to specific protein domains . While all three proteins were identified in membrane fractions, suggesting possible membrane association, comparative analysis of their sequences, predicted structures, and expression patterns would be necessary to establish functional relationships between them. Current research has not established whether these proteins interact with each other or participate in similar biological processes within C. thermocellum.

What are the recommended protocols for recombinant expression of Cthe_0858?

For recombinant expression of Cthe_0858, researchers should consider the following methodology:

  • Vector Selection: Given the thermophilic origin of this protein, expression systems capable of proper folding at higher temperatures may be advantageous. Consider using pET-based expression systems with T7 promoters for E. coli expression.

  • Host Selection: While standard E. coli strains (BL21(DE3), Rosetta) can be used, thermophilic expression hosts may provide better folding environments for proteins from C. thermocellum.

  • Expression Conditions:

    • Initial induction at 0.1-0.5 mM IPTG

    • Test expression at multiple temperatures (16°C, 25°C, 37°C)

    • Consider extended expression times (18-24 hours) at lower temperatures

  • Purification Strategy: Since Cthe_0858 was detected in membrane fractions , include membrane solubilization steps using detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100 prior to purification.

For membrane proteins, additional consideration should be given to fusion tags that can enhance solubility (SUMO, MBP) or aid in membrane protein folding.

What methods are most effective for detecting protein-protein interactions involving Cthe_0858?

For investigating protein-protein interactions of Cthe_0858, consider these methodological approaches:

  • Blue Native-PAGE Analysis: This technique has already proven effective in detecting Cthe_0858 in membrane complexes . Further application with antibody detection can help identify interaction partners.

  • Co-immunoprecipitation (Co-IP): Using antibodies against Cthe_0858 or epitope-tagged versions of the protein to pull down interaction partners from cell lysates.

  • Bacterial Two-Hybrid Systems: Modified for thermophilic proteins if necessary, these systems can detect binary protein interactions.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by MS analysis can identify proximal proteins in native membrane environments.

  • Proximity Labeling: Techniques such as BioID or APEX tagging can identify neighboring proteins in the cellular context.

For membrane proteins like Cthe_0858, methods that preserve membrane integrity during analysis (such as crosslinking prior to solubilization) often provide more physiologically relevant interaction data.

What approaches can be used to determine the function of Cthe_0858 given its limited domain annotation?

Determining the function of poorly annotated proteins like Cthe_0858 requires multiple complementary approaches:

  • Advanced Computational Analysis:

    • Apply structure prediction tools (AlphaFold, RoseTTAFold)

    • Use sensitive homology detection methods (HHpred, HMMER)

    • Analyze genomic context and gene neighborhood

    • Examine conservation patterns across related organisms

  • Experimental Functional Genomics:

    • Generate knockout mutants in C. thermocellum and assess phenotypic changes

    • Perform transcriptomic analysis comparing wild-type and knockout strains

    • Conduct metabolomic profiling to identify affected pathways

  • Localization and Association Studies:

    • Confirm membrane localization using fluorescent protein fusions

    • Identify co-purifying molecules (lipids, metabolites, nucleic acids)

    • Examine expression patterns under various growth conditions

  • Heterologous Expression:

    • Express in model organisms lacking homologs and assess phenotypic changes

    • Test complementation of mutants in related bacteria

The weak domain similarities to PRK 13665, pfam 12127, and COG4864 provide starting points for hypothesis generation, though experimental validation remains essential.

How does the membrane association of Cthe_0858 inform hypotheses about its function?

The membrane association of Cthe_0858 provides important clues about its potential functional roles:

  • Potential Membrane Structural Roles:

    • May contribute to membrane integrity in thermophilic environments

    • Could participate in specialized membrane domains important for C. thermocellum

  • Transport Functions:

    • Given that numerous transporters were identified in the same analysis , Cthe_0858 might function as an accessory protein in membrane transport systems

    • Might be involved in substrate binding or channel regulation

  • Signaling Functions:

    • Could participate in membrane-associated signaling pathways

    • May respond to environmental changes relevant to thermophilic growth

  • Metabolic Associations:

    • May interact with membrane-associated metabolic enzymes

    • Could serve as a membrane anchor for metabolic complexes

To test these hypotheses, researchers should consider:

  • Analyzing changes in membrane properties in knockout strains

  • Examining co-localization with known membrane proteins

  • Testing for specific molecular interactions with lipids or other membrane components

  • Assessing expression changes in response to membrane stress

What strategies can be employed for structural characterization of Cthe_0858?

Structural characterization of Cthe_0858 presents unique challenges due to its hypothetical nature and membrane association. Consider these advanced approaches:

  • Cryo-electron Microscopy (Cryo-EM):

    • Particularly suitable for membrane proteins

    • May require reconstitution in nanodiscs or other membrane mimetics

    • Can capture different conformational states

  • X-ray Crystallography:

    • Challenging for membrane proteins but possible with appropriate detergents or lipidic cubic phase methods

    • Consider fusion partners known to aid crystallization (T4 lysozyme, BRIL)

    • May require extensive screening of crystallization conditions

  • Nuclear Magnetic Resonance (NMR):

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-embedded regions

    • Can provide dynamic information about protein behavior

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides information about solvent accessibility and dynamics

    • Can identify regions involved in interactions

    • Works well for membrane proteins with careful experimental design

  • Small-Angle X-ray Scattering (SAXS):

    • Can provide low-resolution structural information in solution

    • Useful for examining conformational changes

Given the challenges, a hybrid approach combining multiple techniques may yield the most comprehensive structural understanding.

How can genetic manipulation systems in C. thermocellum be optimized for studying Cthe_0858?

Optimizing genetic manipulation of C. thermocellum for studying Cthe_0858 requires specialized approaches:

  • CRISPR-Cas9 Adaptation:

    • Modify CRISPR systems for thermophilic conditions

    • Design guide RNAs specific to Cthe_0858 with careful consideration of off-target effects

    • Use thermostable Cas9 variants or adapt existing systems for higher temperature function

  • Homologous Recombination Strategies:

    • Design deletion constructs with extended homology arms (>1kb) for efficient integration

    • Consider counter-selection markers appropriate for C. thermocellum

    • Optimize transformation protocols for thermophilic conditions

  • Inducible Expression Systems:

    • Develop thermostable inducible promoters for controlled expression

    • Consider systems derived from other thermophiles

    • Design constructs for allelic replacement with tagged versions

  • Reporter Systems:

    • Use thermostable fluorescent proteins or enzymatic reporters

    • Design translational fusions that preserve protein function

    • Consider cellular localization tags for tracking protein distribution

Based on success with genetic modification of C. thermocellum for ethanol production pathways , similar approaches could be adapted for Cthe_0858 studies, with appropriate modifications for membrane protein expression.

How might Cthe_0858 contribute to the unique thermophilic properties of C. thermocellum?

As a membrane-associated protein in a thermophilic organism, Cthe_0858 may contribute to C. thermocellum's thermophilic adaptations in several ways:

  • Membrane Stability:

    • Could provide structural support to maintain membrane integrity at high temperatures

    • May interact with specific lipids that contribute to thermostable membranes

    • Might participate in temperature-dependent phase transitions of the membrane

  • Stress Response:

    • May function in thermal stress response pathways

    • Could protect other membrane proteins from thermal denaturation

    • Might regulate ion or solute transport in response to temperature fluctuations

  • Specialized Metabolism:

    • May participate in thermophile-specific metabolic pathways

    • Could function in temperature-dependent regulatory mechanisms

    • Might be involved in energy conservation strategies unique to thermophiles

To investigate these possibilities, comparative studies with mesophilic homologs (if identifiable) and examination of expression changes during temperature shifts would be informative. Additionally, analyzing the thermal stability of purified Cthe_0858 compared to structural homologs from mesophilic organisms could provide insights into thermoadaptation mechanisms.

What is the relationship between Cthe_0858 and other characterized membrane proteins in C. thermocellum?

Understanding the relationship between Cthe_0858 and other C. thermocellum membrane proteins requires integrative analysis:

  • Co-expression Analysis:

    • Examine transcriptomic data across various growth conditions to identify proteins with similar expression patterns

    • Look for co-regulation with known membrane systems

  • Protein Complex Analysis:

    • Expand upon the BN-PAGE analysis that initially identified Cthe_0858

    • Use pull-down assays with other membrane proteins to test for interactions

  • Functional Relationships:

    • Compare phenotypes between Cthe_0858 knockouts and knockouts of other membrane proteins

    • Look for genetic interactions through double knockout studies

  • Spatial Organization:

    • Use fluorescence microscopy to examine co-localization with other membrane proteins

    • Determine if Cthe_0858 localizes to specific membrane domains

The BN-PAGE analysis already revealed several membrane transport complexes in C. thermocellum , including ABC transporters and solute binding proteins. Investigating potential functional relationships between Cthe_0858 and these characterized transport systems would be a logical research direction.

What are the optimal conditions for isolating native Cthe_0858 from C. thermocellum cultures?

Isolating native Cthe_0858 from C. thermocellum requires specialized methods for membrane protein extraction:

Table 1: Recommended Protocol for Native Cthe_0858 Isolation

StepProcedureCritical Parameters
1. Culture GrowthGrow C. thermocellum to mid-log phase at 60°CMonitor OD600 regularly; harvest at OD600 ~0.8-1.0
2. Cell HarvestingCentrifuge at 5000×g, 10 min, 4°CRapid cooling is essential to preserve protein complexes
3. Cell LysisSonication or French press in buffer with protease inhibitorsBuffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA
4. Membrane IsolationUltracentrifugation at 100,000×g, 1 hr, 4°CMultiple washing steps to remove peripheral proteins
5. Membrane SolubilizationIncubate with gentle detergents (0.5-1% DDM or 1% digitonin)Critical for preserving native protein interactions
6. PurificationBlue-Native PAGE or affinity chromatographyBN-PAGE has already proven effective for detection
7. VerificationWestern blotting, mass spectrometryUse specific antibodies if available

When isolating native Cthe_0858, it's crucial to maintain conditions that preserve its membrane associations and potential protein-protein interactions. The BN-PAGE approach used in previous studies provides a starting point, but may need optimization for preparative-scale isolation.

How can researchers design experiments to resolve contradictory data about Cthe_0858 function?

When faced with contradictory data about Cthe_0858 function, consider these experimental design approaches:

  • Source Evaluation Protocol:

    • Examine methodological differences between contradictory studies

    • Assess growth conditions, strain variations, and experimental parameters

    • Replicate key experiments with standardized protocols

  • Multiple Technique Verification:

    • Apply orthogonal experimental approaches to test each hypothesis

    • For example, combine genetic, biochemical, and structural approaches

    • Create a decision matrix to evaluate consistency across methods

  • Collaborative Cross-validation:

    • Engage multiple laboratories to independently test hypotheses

    • Use matched pairs experimental design to control for laboratory variables

    • Implement standardized reporting of experimental conditions

  • Systematic Variable Testing:

    • Identify key variables that might explain contradictions

    • Design factorial experiments to test combinations of these variables

    • Use statistical methods to identify significant interactions

  • Context-Dependent Function Analysis:

    • Test function under varied growth conditions

    • Examine developmental or growth phase-dependent activities

    • Consider environmental triggers that might activate distinct functions

For membrane proteins like Cthe_0858, contradictions often arise from differences in membrane preparation methods or solubilization conditions, which should be specifically addressed in comparative experiments.

What are the most promising approaches for high-throughput functional screening of Cthe_0858?

High-throughput functional screening of hypothetical proteins like Cthe_0858 requires innovative approaches:

  • Phenotypic Microarray Analysis:

    • Test Cthe_0858 knockout or overexpression strains across hundreds of growth conditions

    • Look for condition-specific phenotypes that reveal function

    • Analyze patterns of metabolic utilization and stress responses

  • Ligand Binding Assays:

    • Develop fluorescence-based or surface plasmon resonance assays

    • Screen libraries of metabolites, signaling molecules, or drugs

    • Use thermal shift assays to identify stabilizing ligands

  • Synthetic Genetic Array Analysis:

    • Create systematic double mutants with other C. thermocellum genes

    • Identify genetic interactions suggesting functional relationships

    • Map Cthe_0858 to specific cellular pathways

  • Protein Interaction Screening:

    • Adapt membrane yeast two-hybrid systems for thermophilic proteins

    • Screen against genomic libraries of C. thermocellum

    • Use protein fragments to map interaction domains

  • Transcriptional Response Profiling:

    • Monitor global transcriptional changes in response to Cthe_0858 manipulation

    • Identify conditions that trigger expression changes

    • Use clustering analysis to place in functional networks

These approaches can be optimized for the membrane protein nature of Cthe_0858, with particular attention to detergent selection and protein stability during screening procedures.

How might computational approaches be leveraged to predict Cthe_0858 functions?

Advanced computational methods offer powerful approaches for predicting functions of hypothetical proteins like Cthe_0858:

  • Deep Learning Structure-Function Prediction:

    • Apply AlphaFold2 or similar tools to predict structure

    • Use structure-based function prediction algorithms

    • Identify potential binding pockets or active sites

  • Evolutionary Analysis:

    • Perform remote homology detection across diverse bacterial genomes

    • Analyze patterns of co-evolution with other genes

    • Examine phylogenetic distribution to infer ancestral functions

  • Genomic Context Analysis:

    • Analyze gene neighborhood conservation across species

    • Identify conserved operonic structures

    • Look for consistent genomic associations

  • Molecular Dynamics Simulations:

    • Model behavior in membrane environments

    • Simulate interactions with potential binding partners

    • Examine conformational changes under various conditions

  • Network-Based Predictions:

    • Integrate with protein-protein interaction networks

    • Use guilt-by-association approaches in metabolic networks

    • Apply Bayesian integration of multiple data types

For Cthe_0858, starting with its weak domain similarities (PRK 13665, pfam 12127, and COG4864) and expanding to more sensitive computational approaches could provide testable hypotheses about its function.

How can knowledge about Cthe_0858 contribute to our understanding of C. thermocellum as a biocatalyst for ethanol production?

Understanding Cthe_0858's function may provide insights relevant to C. thermocellum's biotechnological applications:

  • Membrane Integrity and Stress Tolerance:

    • If Cthe_0858 contributes to membrane stability, it could affect C. thermocellum's tolerance to ethanol and other stressors during fermentation

    • Engineering Cthe_0858 expression might enhance robustness under industrial conditions

  • Metabolic Integration:

    • Understanding Cthe_0858's potential role in membrane transport or signaling could reveal new targets for metabolic engineering

    • May provide insights into rate-limiting steps in substrate utilization or product formation

  • Comparative Advantage Assessment:

    • Comparing Cthe_0858 function to homologs in other biofuel-producing organisms could reveal unique adaptations

    • Could explain C. thermocellum's specific advantages in lignocellulose degradation

  • Bioprocess Optimization:

    • Knowledge of Cthe_0858's response to process conditions might inform fermentation parameter optimization

    • Could lead to targeted genetic modifications improving ethanol yields, similar to previously successful genetic engineering approaches in C. thermocellum

While direct connections to ethanol production pathways remain to be established, membrane proteins often play crucial roles in cellular responses to industrial process conditions.

What are the best practices for designing reproducible experiments involving Cthe_0858?

Ensuring reproducibility in Cthe_0858 research requires careful attention to experimental design:

  • Strain and Construct Documentation:

    • Maintain detailed records of C. thermocellum strains and genetic modifications

    • Document passage number and storage conditions

    • Consider strain deposition in public repositories

  • Growth Condition Standardization:

    • Define precise media composition, temperature, and anaerobic conditions

    • Monitor and report growth phase at harvesting

    • Use consistent carbon sources and concentrations

  • Membrane Preparation Protocols:

    • Standardize cell disruption methods

    • Document all buffer compositions, including pH and ionic strength

    • Specify detergent types, concentrations, and solubilization conditions

  • Data Collection and Analysis Transparency:

    • Pre-register experimental designs and analysis plans

    • Share raw data in public repositories

    • Document all data processing steps and statistical methods

  • Method Reporting Checklist:

    • Provide equipment models and settings

    • Include all quality control metrics

    • Report both positive and negative results

For membrane proteins like Cthe_0858, reproducibility challenges often stem from subtle variations in membrane preparation and protein extraction methods, which should receive particular attention in experimental design and reporting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.