Recombinant Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Biological Role

CobD exhibits L-threonine-O-3-phosphate decarboxylase activity, essential for producing (R)-1-amino-2-propanol O-2-phosphate (AP-P) . This compound is incorporated into adenosylcobyric acid by CbiB to form adenosylcobinamide phosphate, a penultimate intermediate in cobalamin biosynthesis . Key characteristics include:

  • Substrate specificity: Exclusively acts on phosphorylated L-threonine derivatives .

  • Cofactor dependence: Requires pyridoxal 5′-phosphate (PLP) for catalysis, typical of aminotransferases .

  • Bifunctionality in archaea: In Methanosarcina mazei, CobD also possesses L-threonine kinase activity, enabling phosphorylation of L-threonine to L-threonine-O-3-phosphate .

Recombinant Expression and Applications

Recombinant CobD has been successfully produced in heterologous systems for functional studies:

  • Cloning and overexpression: S. typhimurium CobD was overexpressed in E. coli, yielding active enzyme for crystallography and kinetic assays .

  • Archaeal variants: M. mazei CobD expressed in E. coli retained dual enzymatic activities, though Fe-binding mutants showed reduced activity (e.g., C-terminal cysteine/histidine substitutions decreased activity by 60–80%) .

  • Biotechnological potential: Engineered CobD variants could optimize cobalamin production in industrial microbes like Bacillus megaterium, where metabolic bottlenecks exist in aminopropanol synthesis .

Mechanistic Insights from Mutational Studies

  • PLP-binding motif: Mutation of K274 in S. typhimurium CobD abolished decarboxylase activity, confirming its role in cofactor anchoring .

  • Iron dependence: Deletion of the Fe-binding C-terminus in M. mazei CobD reduced activity by 50%, suggesting iron stabilizes the tertiary structure .

  • Kinase activity: Archaeal CobD phosphorylates L-threonine via a distinct active site, absent in bacterial homologs .

Evolutionary and Functional Diversity

CobD orthologs exhibit divergent roles across species:

  • Bacteria: Primarily decarboxylases (e.g., S. typhimurium) .

  • Archaea: Bifunctional enzymes with kinase and decarboxylase activities (e.g., M. mazei) .

  • Horizontal gene transfer: Genes encoding archaeal CobD-like proteins are found in bacteria, suggesting evolutionary exchange of cobalamin salvage pathways .

Regulatory Interactions

While CobD itself is not directly regulated by small molecules, its activity intersects with broader metabolic networks:

  • Feedback inhibition: Cobalamin represses cobD transcription in some organisms via riboswitches .

  • Cross-pathway coordination: In E. coli, CobB (a sirtuin deacetylase) modulates c-di-GMP levels, indirectly influencing cobalamin-dependent processes .

Research Challenges and Future Directions

  • Activity assays: CobD’s oxygen sensitivity complicates in vitro studies, necessitating anaerobic conditions .

  • Structural dynamics: The role of the Fe-binding domain in M. mazei CobD remains unclear, warranting further spectroscopic analysis .

  • Industrial scaling: Enhancing CobD expression in recombinant hosts could address yield limitations in synthetic cobalamin production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobD; CTC_00721; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Clostridium tetani (strain Massachusetts / E88)
Target Names
cobD
Target Protein Sequence
MGLIDIIVAVLLDFAIGDPYWFPHPVIYIGKLISYLEEVGRKHFKSNKGLKTLGGLVVLT IAITSFGIPFLILWMVKDSFWIFHFLNIILIWTTLAAKSLKVEGKRVYYALKNEDIQEAR EKLSYIVGRDTRNLTEEEIIRADIETIMENTADGVIAPLFYAMIGGAPFAMMYKGINTMD SMLGYMNDKYIHLGFFPAKVDDVFNFIPARISGVLICLSAPIVKGNIIRSFKVMLRDRKN HKSPNCAYPEGAGAGVMGIQLGGTNVYFGKAVYKPTIGDRIKDLHHELINDSVKLMYASE TLMVIIYALTVTSYNLR
Uniprot No.

Target Background

Function
Catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.