Recombinant Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Definition and Enzymatic Role

Recombinant Cobalamin Synthase (CobS) refers to the genetically engineered or purified form of the enzyme that synthesizes adenosylcobalamin-5′-phosphate (AdoCbl-5′-P), the phosphorylated precursor of active cobalamin. It catalyzes the condensation of two substrates:

  • Adenosylcobinamide-GDP (AdoCbi-GDP), derived from the CobU-catalyzed guanylylation of adenosylcobinamide .

  • α-Ribazole-5′-phosphate (α-RP), generated by CobT-mediated phosphoribosylation of 5,6-dimethylbenzimidazole (DMB) .

This reaction forms the nucleotide loop structure essential for cobalamin’s biological activity .

Key Properties of CobS

PropertyValue/DescriptionSource OrganismReference
Molecular Weight~280 kDa (homomultimeric structure)Mycobacterium spp.
Catalytic Activity38–341 nmol/min/mg (varies by system)S. typhimurium
Optimal pH7.5–8.0S. typhimurium
Cofactor RequirementMg²⁺ or Mn²⁺S. typhimurium

Reaction Mechanism

CobS facilitates a nucleotidyl transfer reaction, forming a phosphodiester bond between AdoCbi-GDP and α-RP. The product, AdoCbl-5′-P, is subsequently dephosphorylated by CobC to yield active adenosylcobalamin .

In Vitro Synthesis of AdoCbl-5′-P

  • Purified CobS from S. typhimurium successfully synthesized AdoCbl-5′-P in reactions containing AdoCbi-GDP and α-RP, confirmed via HPLC and mass spectrometry .

  • The enzyme exhibited a Km of 12 µM for α-RP and 25 µM for AdoCbi-GDP, indicating high substrate affinity .

CobS Overexpression and Cellular Effects

  • In Escherichia coli, elevated CobS levels disrupted membrane integrity, as shown by:

    • Increased ethidium bromide uptake (indicative of compromised membranes) .

    • Morphological abnormalities observed via FM4-64 fluorescence staining .

    • Reduced cell viability (up to 90% loss in colony-forming units at 1 mM IPTG induction) .

Industrial and Biotechnological Applications

Recombinant CobS enables:

  • Custom cobamide synthesis: Tailored cobamides with alternative lower-ligand bases can be produced for studying cobalamin-dependent enzymes .

  • Vitamin B12 production: Engineered microbial systems using CobS could optimize industrial cobalamin biosynthesis .

Key Challenges and Future Directions

  • Substrate channeling: Kinetic analyses are needed to determine whether CobS operates in a substrate-sequestered complex with CobU or CobT .

  • Membrane interactions: The physiological role of CobS’s transmembrane domain remains unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; MAP_1949; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Target Names
cobS
Target Protein Sequence
MMRSLATAFAFGTVLPVPAGGRGPMGRGAMTALPVVGLALGALAAAVAWGGAVVFGRSSP LGGLLAVAALLLITRGLHIDGVADTADGLGCYGPPDRARAVMRDGSTGPFGVAAVVVVVM AQALAFSALAAGRPVPVGVAVAVFAGRVAAVLACRRTVPAAAGSSLGATVAGSQPATVAA AWVAVLLGMSLVAGPRPWHGPVAVLLGLGCGGVLVRHCVRRFGGISGDVLGAAIELTATV SAVALAALVRV
Uniprot No.

Target Background

Function

Cobalamin synthase (CobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what is its role in B12 biosynthesis?

Cobalamin synthase (CobS) is an enzyme that catalyzes a critical step in the nucleotide loop assembly pathway of adenosylcobalamin (vitamin B12) biosynthesis. Specifically, CobS functions as the cobalamin(-5'-phosphate) synthase, responsible for joining the lower ligand base component to the corrin ring structure. The enzyme catalyzes the synthesis of adenosylcobalamin-5'-phosphate from adenosylcobinamide-GDP and α-ribazole-5'-phosphate, essentially completing the structure of the vitamin except for the terminal phosphate group . This reaction represents one of the final steps in the complex B12 biosynthetic pathway, which involves over 30 enzymatic reactions in aerobic bacteria. CobS works in concert with other enzymes including CobU, CobT, and CobC to complete the nucleotide loop assembly portion of the pathway .

What are the substrates and products of the CobS reaction?

The CobS enzyme catalyzes a specific reaction in the nucleotide loop assembly:

Substrates:

  • Adenosylcobinamide-GDP (AdoCbi-GDP): The product of the CobU reaction

  • α-Ribazole-5'-phosphate: The product of the CobT reaction

Product:

  • Adenosylcobalamin-5'-phosphate (AdoCbl-5'-P)

This reaction involves the attachment of the nucleotide (α-ribazole-5'-phosphate) to adenosylcobinamide-GDP to form adenosylcobalamin-5'-phosphate. Experimental evidence has demonstrated that CobS can use α-ribazole-5'-phosphate as a substrate without requiring the action of CobC first, answering a key question about the order of enzymatic steps in the pathway . The final product (AdoCbl) is formed when CobC subsequently removes the 5'-phosphate group from AdoCbl-5'-P.

What are the common challenges in expressing recombinant CobS?

Expressing recombinant CobS presents several challenges similar to those encountered with other cobalamin-related enzymes:

These challenges necessitate specialized expression systems and conditions to obtain functional recombinant CobS.

Which expression systems and strategies improve CobS solubility?

Several approaches have proven effective for improving the solubility and yield of recombinant CobS:

  • Coexpression with chaperone systems: Similar to strategies used for cobalamin-dependent enzymes, coexpression with molecular chaperones can improve folding and solubility

  • Specialized plasmid systems: Although not specifically mentioned for CobS, systems that have worked for similar cobalamin-binding proteins include:

    • pDB1282 containing the isc operon from Azotobacter vinelandii, which encodes genes involved in Fe-S cluster biogenesis (has improved solubility for several related enzymes)

    • The pBAD42-BtuCEDFB plasmid, which encodes a cobalamin uptake system and significantly improves solubility of cobalamin-dependent enzymes

  • Modified growth media: Using ethanolamine-M9 medium to drive the uptake of cobalamin into E. coli during protein expression

  • Optimized expression conditions: Lower temperatures (16-18°C), reduced IPTG concentrations, and extended induction times often improve soluble protein yield

  • Fusion tags: N-terminal solubility tags such as MBP (maltose-binding protein), SUMO, or TrxA can dramatically improve solubility, though care must be taken to ensure activity is maintained after tag removal

How can recombinant CobS activity be preserved during purification?

To maintain CobS activity during purification:

  • Buffer optimization: Include stabilizing agents such as glycerol (10-20%), reducing agents (DTT or β-mercaptoethanol), and appropriate salt concentrations

  • Cobalamin supplementation: Adding hydroxocobalamin or adenosylcobalamin to purification buffers may help maintain the proper folding of the enzyme

  • Limited proteolysis prevention: Include protease inhibitor cocktails during initial lysis steps

  • Temperature control: Perform all purification steps at 4°C and avoid freeze-thaw cycles

  • Rapid purification: Minimize the time between cell lysis and final purification step to reduce chances of protein degradation

What assays can be used to measure CobS activity in vitro?

Several assays have been developed to measure CobS activity:

  • Functional complementation: The product of the CobS reaction (adenosylcobalamin-5'-phosphate) can be isolated and tested for its ability to support growth of a cobalamin auxotroph strain like S. typhimurium JE212 . This biological assay confirms that the product is functionally active.

  • HPLC analysis: Reaction products can be analyzed by reverse-phase HPLC (RP-HPLC) to separate and identify adenosylcobalamin-5'-phosphate. This can be coupled with:

    • UV-visible spectroscopy detection (characteristic absorption spectrum of cobalamin)

    • Mass spectrometry for product identification

  • Radiolabeled substrate assay: Using radiolabeled substrates (e.g., labeled AdoCbi-GDP) and measuring incorporation into the final product. This method has been used to quantitate specific activities of approximately 8-22 nmol of product per min per mg of protein in cell-free extracts .

  • Coupled enzyme assays: Designing assays where the activity of CobS is coupled to another enzyme reaction that can be more easily monitored by spectrophotometric methods.

What are the kinetic properties of the CobS enzyme?

The kinetic analysis of CobS is still being developed, but key considerations include:

  • Substrate affinity: CobS can utilize α-ribazole-5'-phosphate as a substrate, though the relative efficiency compared to using α-ribazole (the dephosphorylated form) requires further kinetic analysis

  • Reaction rates: In cell-free extract experiments, CobS has shown specific activities of approximately 8 nmol of product per min per mg of protein in extracts from cells carrying the cobS gene alone, and 22 nmol of product per min per mg in extracts from cells carrying cobUST genes together

  • Cofactor effects: Complete kinetic characterization should include analysis of how various reaction conditions and potential cofactors affect the enzyme's activity

  • Substrate inhibition: At high concentrations, substrates may potentially inhibit the reaction, though specific data for CobS is limited

The comprehensive kinetic analysis of the CobS reaction with α-ribazole or α-ribazole-5'-phosphate as substrates would help define the precise timing of phosphate removal in vivo .

How can CobS be used for in vitro synthesis of cobalamin analogs?

CobS offers unique opportunities for the synthesis of structurally modified cobalamins:

  • Base-modified analogs: By providing CobS with different lower ligand bases instead of 5,6-dimethylbenzimidazole (DMB), researchers can generate cobalamin analogs with altered lower ligands. The in vitro system developed for CobS "offers a unique opportunity for the rapid synthesis and isolation of cobamides with structurally different lower-ligand bases" .

  • Investigating structure-function relationships: These cobalamin analogs can be used to investigate the contributions of the lower-ligand base to cobalamin-dependent reactions, providing insight into how structural modifications affect biological function .

  • Isotopic labeling: The in vitro system allows for incorporation of isotopically labeled precursors at specific positions in the cobalamin structure, useful for NMR studies or metabolic tracing experiments.

  • Synthetic biology applications: CobS can be integrated into synthetic biological pathways for the production of novel cobalamin derivatives with potentially enhanced or modified properties.

How does CobS coordinate with other enzymes in the cobalamin biosynthetic pathway?

The CobS enzyme works in a coordinated sequence with other enzymes in the nucleotide loop assembly pathway:

  • Pathway coordination:

    • CobU: Converts adenosylcobinamide (AdoCbi) and GTP to adenosylcobinamide-GDP (AdoCbi-GDP)

    • CobT: Synthesizes α-ribazole-5'-phosphate from 5,6-dimethylbenzimidazole (DMB) and nicotinate mononucleotide (NaMN)

    • CobS: Joins AdoCbi-GDP and α-ribazole-5'-phosphate to form adenosylcobalamin-5'-phosphate

    • CobC: Dephosphorylates adenosylcobalamin-5'-phosphate to form adenosylcobalamin

  • Enzyme interactions: While direct physical interactions between these enzymes have not been definitively established, the sequential nature of the reactions suggests possible metabolic channeling or substrate transfer mechanisms worthy of investigation.

  • Timing considerations: The experimental evidence suggests flexibility in the pathway, as CobS can use α-ribazole-5'-phosphate as a substrate without requiring prior dephosphorylation by CobC. This implies that the timing of the CobC dephosphorylation step may depend on the relative activities and affinities of CobS and CobC for their respective substrates .

Why might recombinant CobS show low or no activity?

Several factors may contribute to low CobS activity in recombinant systems:

  • Improper folding: Expression in heterologous hosts may result in misfolded protein, especially if cobalamin is not available during expression

  • Cofactor deficiency: Insufficient cobalamin in the expression system or reaction buffer can lead to reduced activity

  • Substrate quality: Degraded or impure substrates (AdoCbi-GDP or α-ribazole-5'-phosphate) will reduce detectable activity

  • Buffer composition: Suboptimal pH, salt concentration, or missing divalent cations may significantly affect activity

  • Oxidative damage: Exposure to oxidizing conditions may damage the enzyme or cofactors

  • Inhibitory contaminants: Presence of inhibitory compounds from the purification process or expression host

  • Improper storage: Enzyme degradation due to inappropriate storage conditions or repeated freeze-thaw cycles

What control experiments should be included when working with CobS?

Robust experimental design with CobS should include:

  • Negative controls:

    • Reaction mixtures lacking CobS to detect any non-enzymatic conversion

    • Heat-inactivated CobS to confirm activity is enzyme-dependent

    • Reactions with individual substrates omitted to confirm substrate requirements

  • Positive controls:

    • Known active preparations of CobS when testing new expression or purification methods

    • Cell-free extracts from strains carrying plasmids that express functional CobS (such as pCOBS4) can serve as positive controls

  • Specificity controls:

    • Testing substrate analogs to confirm enzyme specificity

    • Using extracts from cells carrying control vectors (e.g., pT7-7 without the cobS gene) to confirm that observed activity is specifically due to CobS

  • Analytical controls:

    • Pure standards of expected products for chromatographic comparison

    • Internal standards for quantitative measurements

Substrate and product characteristics

CompoundMolecular WeightDetection MethodBiological Activity
AdoCbi-GDP (substrate)Not specified in sourcesNot specifiedN/A
α-Ribazole-5'-phosphate (substrate)Not specified in sourcesNot specifiedN/A
AdoCbl-5'-P (product)Not specified in sourcesUV-visible spectroscopy, mass spectrometrySupports growth of cobalamin auxotroph strain JE212
AdoCbl (final product after CobC)Not specified in sourcesNot specifiedComplete cobalamin activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.