Recombinant Cobalamin synthase (cobV)

Shipped with Ice Packs
In Stock

Description

Enzyme Nomenclature and Organism-Specific Variants

Cobalamin synthase is designated differently across bacterial species:

  • CobS in Salmonella typhimurium (anaerobic pathway) .

  • CobV in Pseudomonas denitrificans (aerobic pathway) .
    The recombinant form of this enzyme is often expressed with affinity tags (e.g., His₆) for purification and functional studies .

Catalytic Activity

Cobalamin synthase (e.g., CobS) links two key intermediates:

  1. Adenosylcobinamide-GDP (activated by CobU) .

  2. α-Ribazole-5′-phosphate (generated by CobT) .
    This results in adenosylcobalamin-5′-phosphate (AdoCbl-5′-P), a precursor to active adenosylcobalamin .

Key Biochemical Steps

StepEnzymeSubstrateProduct
1CobUAdenosylcobinamide + GTPAdenosylcobinamide-GDP
2CobTNicotinate mononucleotide + 5,6-dimethylbenzimidazoleα-Ribazole-5′-phosphate
3CobSAdenosylcobinamide-GDP + α-Ribazole-5′-phosphateAdenosylcobalamin-5′-phosphate
4CobCAdenosylcobalamin-5′-phosphateAdenosylcobalamin

Recombinant CobS Activity

Purified His₆CobS from Salmonella typhimurium demonstrated:

  • Specific Activity: 8 nmol/min/mg protein when using AdoCbi-GDP and α-ribazole-5′-P .

  • Substrate Flexibility: CobS can utilize α-ribazole-5′-P directly, bypassing the need for CobC in in vitro systems .

Growth Rescue Experiments

AdoCbl-5′-P synthesized via recombinant CobS supported:

  • Growth of cobalamin auxotrophs (e.g., Salmonella JE212) .

  • UV-Vis and Mass Spectrometry Confirmation: AdoCbl-5′-P was validated as a functional intermediate .

Dephosphorylation by CobC

CobC removes the 5′-phosphate group from AdoCbl-5′-P:

  • Substrate Specificity: Acts on both α-ribazole-5′-P and AdoCbl-5′-P .

  • Kinetic Implications: The timing of phosphate removal in vivo depends on relative enzyme affinities and substrate availability .

Comparative Insights Across Organisms

OrganismPathwayKey EnzymeCobalt Incorporation
Salmonella typhimuriumAnaerobicCobSEarly (during corrin synthesis)
Pseudomonas denitrificansAerobicCobVLate (after corrin synthesis)

Challenges and Future Directions

  • Recombinant cobV Studies: Limited data exist for Pseudomonas CobV; most studies focus on Salmonella CobS .

  • Structural Elucidation: Crystallographic studies are needed to resolve how cobV/CobS binds substrates and catalyzes nucleotide loop formation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobV; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Pseudomonas denitrificans
Target Names
cobV
Target Protein Sequence
MGFVGDFCDDVARSIGFLSRIPMPARHFEGYDGRLSRAVRAFPFAGLAIALPSAAVAMAL MALQVSSLFAAFVVVAIQALVTGALHEDGLGDTADGFGGGRDREAALAIMKDSRIGTYAA VALILSFGLRVSAFASILPLFSPLGAAMAILGAACLSRAAMVWHWSSLPPARSSGVAASA GEPEPAATRFALAFGLLVAMLLFYLAQVPALGVIAALVAFLATVKGFARLAMRKIGGQTG DTIGATQQLTEIAVLGALALTV
Uniprot No.

Target Background

Function

Cobalamin synthase (CobV) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the functional role of cobalamin synthase in vitamin B12 biosynthesis?

  • How do the CobS and CobV proteins differ between bacterial species?

CobS (Salmonella) and CobV (Pseudomonas) are homologous proteins that perform equivalent functions but differ in their sequence identity and potentially in their biochemical properties:

FeatureCobS (Salmonella)CobV (Pseudomonas)
Molecular weight~26-28 kDa~28-30 kDa
Optimal pH range7-10Similar to CobS
Specific activity8-22 nmol/min/mgNot specified in sources
Expression levelLow (not visible on Coomassie-stained gels)Variable by strain

The assignment of CobS as the cobalamin synthase was initially based strictly on its homology to the CobV protein of Pseudomonas denitrificans . While functionally equivalent, the nucleotide sequences between Salmonella and other species like E. coli are quite divergent, suggesting they may not have been derived from a common ancestor but rather introduced from exogenous sources in some lineages .

  • What are the immediate precursors and products in the cobalamin synthase reaction?

The cobalamin synthase reaction involves specific substrates and products:

SubstratesProducts
Adenosylcobinamide-GDP (AdoCbi-GDP)Adenosylcobalamin-5′-phosphate (AdoCbl-5′-P)
α-Ribazole-5′-phosphate-
Mg²⁺ (cofactor)-

The reaction links the lower ligand nucleotide (α-ribazole-5′-phosphate) to the corrin ring structure (adenosylcobinamide-GDP), forming the complete cobalamin structure with a phosphate group that is subsequently removed by the CobC phosphatase . This reaction is part of the nucleotide loop assembly pathway, which is essential for completing the vitamin B12 structure.

Methodological Approaches

  • What expression systems are most effective for producing functional recombinant CobV protein?

Based on studies with homologous cobalamin synthases, several expression systems show promise:

Expression SystemAdvantagesLimitationsNotes
Homologous expressionNative folding environment, optimal codon usageLimited yield in some speciesPreferred for functional studies
E. coli with pET vectorsHigh yield potential, well-established protocolsInclusion body formation possibleHis-tags facilitate purification
B. megaterium systemsNatural cobalamin producer, good for enzyme complexesMore complex geneticsEffective for pathway reconstitution

For CobS from Salmonella, expression using the pCOBS4 plasmid in native hosts provided active enzyme, though at levels below visual detection on protein gels . When expressing His-tagged CobS (using pCOBS5), standard nickel affinity chromatography captured only 2.4% of the total activity, suggesting optimization challenges . Expression conditions requiring experimental optimization include:

  • Induction temperature and duration

  • Media composition (particularly trace metals)

  • Codon optimization (if using heterologous systems)

  • Tags and fusion partners that minimize activity interference

  • How can in vitro reconstitution of the complete cobalamin biosynthetic pathway be achieved?

Complete in vitro reconstitution of cobalamin biosynthesis represents a powerful approach for studying pathway enzymes and intermediates. Based on successful reconstitution experiments:

a) Enzyme requirements:

  • For nucleotide loop assembly: CobU, CobS, CobT, and CobC proteins

  • For complete de novo synthesis from 5-aminolevulinic acid: 14 purified enzymes

b) Reaction conditions:

  • Basic reaction buffer: 0.1 M CHES buffer (pH 9.0), 2.5 mM MgCl₂

  • For nucleotide loop assembly: adenosylcobinamide (60 μM), GTP (2 mM), DMB (100 μM), NaMN (1 mM)

  • Temperature: 37°C

  • Light protection: Reactions performed under dim light or darkness to prevent photolysis of C-Co bonds

c) Analysis methods:

  • Bioassays with cobalamin auxotrophs

  • RP-HPLC with UV-visible spectroscopy

  • Mass spectrometry for product identification

  • Polyethyleneimine cellulose TLC for radioactive assays

The successful assembly of the nucleotide loop in vitro from adenosylcobinamide, GTP, 5,6-dimethylbenzimidazole, and nicotinate mononucleotide has been demonstrated using purified CobU, CobS, and CobT enzymes . This approach offers opportunities for synthesizing cobalamin analogs with modified lower ligands for mechanistic studies.

  • What analytical techniques are most informative for characterizing cobalamin synthase reaction intermediates?

Multiple complementary analytical techniques are necessary to fully characterize the unstable intermediates in the cobalamin synthesis pathway:

a) UV-visible spectroscopy:

  • Rapid assessment of intermediates with distinctive spectra

  • For example, cobalt-precorrin-6A exhibits peaks at 335 and 436 nm, while cobalt-precorrin-6B shows peaks at 318 and 419 nm

  • Cobalamin products show characteristic spectra with peaks at ~361, ~520, and ~550 nm

b) Mass spectrometry:

  • Provides molecular weight confirmation of products

  • Useful for identifying modifications and adducts

  • Challenging with unstable intermediates that degrade during analysis

c) EPR spectroscopy:

  • Particularly valuable for paramagnetic Co(II) intermediates

  • Reveals unusual electron configuration in cobalt d-orbitals

  • Has proven effective in following transformations with cobalt(II) paramagnetic electrons in the dyz orbital

d) Chromatographic methods:

  • RP-HPLC with characteristic retention times:

    • CNCbl: 36.9 min

    • CNCbl-5′-P: 33.5-33.6 min

    • (CN)₂Cbi-GDP: 29 min

    • (CN)₂Cbi: 32.3 min

e) NMR spectroscopy:

  • Provides structural details but challenging due to paramagnetic cobalt

  • Multiple tautomeric species complicate interpretation

Each technique has limitations, particularly for unstable intermediates. For example, cobalt-precorrin-6B has been shown to rapidly convert to other forms when pH is lowered below 6.5, leading to identical mass spectra for different intermediates .

Research Challenges

  • What are the major challenges in studying the mechanism of cobalamin synthase?

Several significant challenges complicate mechanistic studies of cobalamin synthase:

a) Protein expression difficulties:

  • Low expression levels (not visible by Coomassie staining)

  • Poor affinity purification yields (2.4% recovery with His-tags)

  • Potential misfolding in heterologous systems

b) Reactive intermediates:

  • Sensitivity to oxygen and light

  • pH-dependent stability (some intermediates degrade below pH 6.5)

  • Multiple tautomeric forms complicating structural analysis

c) Complex substrate requirements:

  • Need for specialized precursors not commercially available

  • Requirement to synthesize substrates enzymatically

  • Potential for substrate channeling making isolated enzyme studies artificial

d) Analytical limitations:

  • Necessity for multiple complementary techniques

  • Challenges in distinguishing similar corrinoid species

  • Difficulties in obtaining crystal structures of pathway enzymes

These challenges have contributed to the slower elucidation of the anaerobic cobalamin biosynthesis pathway compared to the aerobic route. Recent approaches using homologously overproduced enzymes and enzyme mixture reactions have helped overcome some of these obstacles .

  • How do the aerobic and anaerobic pathways for cobalamin biosynthesis differ in their enzymatic requirements?

The two pathways for cobalamin biosynthesis differ fundamentally in the timing of cobalt insertion and oxygen requirements:

FeatureAerobic PathwayAnaerobic Pathway
Cobalt insertionLate (after ring contraction)Early (before ring contraction)
Oxygen requirementMolecular oxygen neededNo oxygen required
Pathway designation"Cobalt-late""Cobalt-early"
Key enzymesCobA, CobI, CobJ, CobM, CobF, CobLCysG, CbiL, CbiH, CbiF, CbiE, CbiD
C-1 methylationBy CobF (releases acetic acid)By CbiG/CbiD (releases acetaldehyde)
Intermediate stabilityMore stable intermediatesMany unstable intermediates
Model organismPseudomonas denitrificansSalmonella typhimurium, Bacillus megaterium

A key mechanistic difference involves the methylation at C-1 position of the corrin ring. In the aerobic pathway, CobF methylates C-1 and aids in removing the extruded C-20 as acetic acid. In contrast, the anaerobic pathway uses two unique enzymes: CbiG (opens δ-lactone ring and extrudes C-20 as acetaldehyde) and CbiD (methylates C-1), resulting in a double bond that must be subsequently reduced by CbiJ .

Despite these differences, the final stages of nucleotide loop assembly (involving CobU, CobS/CobV, CobT, and CobC) are similar in both pathways, representing a conserved module in cobalamin biosynthesis .

Advanced Applications

  • How can recombinant cobalamin synthase be utilized for the production of vitamin B12 analogs?

Recombinant cobalamin synthase offers unique opportunities for synthesizing modified cobalamin molecules:

a) Lower ligand modifications:

  • The in vitro nucleotide loop assembly system allows incorporation of alternative bases in place of 5,6-dimethylbenzimidazole

  • This approach enables systematic structure-activity relationship studies

  • Modified bases can alter cobalamin binding to transport proteins and enzymes

b) Methodological approach:

  • Substitute DMB with alternative bases in the CobT reaction

  • Use purified CobU, CobT, and CobS enzymes with adenosylcobinamide

  • Isolate products by RP-HPLC

  • Characterize by UV-visible spectroscopy and mass spectrometry

  • Test functional activity with cobalamin-dependent enzymes

The in vitro system offers a "unique opportunity for the rapid synthesis and isolation of cobamides with structurally different lower-ligand bases that can be used to investigate the contributions of the lower-ligand base to cobalamin-dependent reactions" . This approach has significant advantages over chemical synthesis methods, which are challenging due to cobalamin's structural complexity.

  • What insights into evolutionary biology have emerged from studying cobalamin biosynthesis genes?

Comparative genomic analyses of cobalamin biosynthesis genes have revealed fascinating evolutionary patterns:

a) Horizontal gene transfer:

  • The cob genes in Salmonella typhimurium and Escherichia coli are homologous but "too divergent to have been derived from an operon present in their most recent common ancestor"

  • Analysis of G+C content, codon usage bias, dinucleotide frequencies, and substitution patterns suggests the cob operon was introduced into Salmonella from an exogenous source

b) Pathway modularity:

  • The aerobic and anaerobic pathways share similar enzyme functions despite sequence divergence

  • The nucleotide loop assembly module (CobU, CobS, CobT, CobC) appears more conserved than other pathway segments

c) Selective pressures:

  • Differences in cobalamin-dependent metabolism between pathogenic and non-pathogenic mycobacteria reveal "selective pressures which might have shaped mycobacterial metabolism for pathogenicity"

  • Loss of cobalamin biosynthesis genes in some species balanced by acquisition of transport systems

d) Regulatory mechanisms:

  • Cobalamin riboswitches regulate gene expression in response to cobalamin levels

  • In mycobacteria, cobalamin availability controls which methionine synthase is used (MetE vs. MetH)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.