Recombinant Coccidioides immitis Assembly factor CBP4 (CBP4)

Shipped with Ice Packs
In Stock

Description

Introduction to Coccidioides immitis Assembly Factor CBP4

Coccidioides immitis is a thermally dimorphic fungal pathogen responsible for coccidioidomycosis, commonly known as Valley Fever. This endemic fungal infection is characterized by a rising incidence and expanding geographic range across semiarid regions of the Western Hemisphere . The fungus demonstrates a complex life cycle, growing as mycelia in soil but transitioning to pathogenic spherules when inhaled into mammalian lungs . This morphological transition is accompanied by large-scale transcriptional reprogramming that facilitates the pathogen's adaptation to the host environment.

Assembly factor CBP4, also known as Cytochrome b mRNA-processing protein 4, is encoded by the CBP4 gene (CIMG_10084) in the C. immitis genome . This protein represents one component of the complex molecular machinery involved in the fungal pathogen's biological processes.

Expression Systems

Recombinant C. immitis Assembly factor CBP4 protein is typically produced using bacterial expression systems. The most common approach involves expressing the protein in Escherichia coli with an N-terminal histidine (His) tag to facilitate purification . This expression system allows for efficient production of the protein for research and analytical purposes.

The expression construct contains the full-length coding sequence (1-111 amino acids) of the CBP4 gene, enabling the production of the complete functional protein .

Purification Protocols

Table 1: Standard Purification Protocol for Recombinant CBP4

StepProcedureDetails
1ExpressionRecombinant protein expressed in E. coli with N-terminal His tag
2Cell LysisBacterial cells disrupted to release expressed protein
3Affinity ChromatographyHis-tagged protein isolated using nickel or cobalt resins
4Quality ControlPurity assessment by SDS-PAGE (typically >90% purity)
5LyophilizationConversion to stable lyophilized powder form

The purified protein is typically analyzed by SDS-PAGE to confirm its purity, which generally exceeds 90% .

Potential Metabolic Functions

The name "Assembly factor CBP4" suggests a role in molecular assembly processes within the fungal cell. The alternative name "Cytochrome b mRNA-processing protein 4" indicates potential involvement in the processing of cytochrome b mRNA, suggesting a role in mitochondrial function and energy metabolism .

In the context of C. immitis biology, the transition from soil-dwelling mycelia to pathogenic spherules in the host involves massive transcriptional reprogramming and metabolic adjustments . During this morphological transition, gene expression patterns change dramatically to adapt to the new environment and evade host immune responses.

Role in Pathogenesis

While the specific role of CBP4 in C. immitis pathogenesis has not been explicitly detailed in the available research, proteins involved in mitochondrial function and energy metabolism are often critical for pathogen survival and adaptation within host environments .

The morphological transition of C. immitis from mycelia to spherules, which is essential for its pathogenicity, depends on complex transcriptional networks and regulatory mechanisms . Understanding the function of proteins like CBP4 may provide insights into the pathogen's ability to establish infection and cause disease.

Epidemiological Significance

Coccidioidomycosis is an occupational disease affecting workers exposed to outdoor dust containing fungal spores . Additionally, individuals with compromised T-cell immunity, the elderly, and certain racial groups (particularly African-Americans and Filipinos) residing in endemic regions of the southwestern United States have an elevated risk of symptomatic infection .

As climate change continues to alter environmental conditions, models predict an expansion of endemic areas and a significant increase in Valley Fever cases . This underscores the importance of understanding the molecular biology of C. immitis, including the role of proteins like CBP4.

Relevance to Vaccine Development

Efforts to develop vaccines against coccidioidomycosis have focused primarily on recombinant protein vaccines . While CBP4 itself has not been specifically identified as a vaccine candidate in the available research, studies on recombinant C. immitis proteins have shown varying degrees of success in stimulating protective immune responses .

A genetically engineered, live, attenuated vaccine has demonstrated protection in mouse models against coccidioidomycosis . Further research into proteins involved in the fungal life cycle, potentially including CBP4, may contribute to improved vaccine design strategies.

Research Applications

Table 2: Potential Research Applications for Recombinant CBP4

ApplicationDescriptionRelevance
Antibody ProductionGeneration of anti-CBP4 antibodiesDetection and localization studies
Functional StudiesAnalysis of protein interactions and enzymatic activitiesUnderstanding metabolic pathways
Diagnostic DevelopmentPotential use in immunoassaysIdentification of C. immitis infection
Structural BiologyCrystallography and structural analysisDetermination of protein function
Drug Target ValidationScreening of inhibitory compoundsDevelopment of antifungal agents

The availability of recombinant CBP4 enables researchers to investigate its structure, function, and potential applications in diagnostics or therapeutics for coccidioidomycosis .

Transcriptional Regulation Studies

Future research could investigate the role of CBP4 in the transcriptional reprogramming that occurs during the transition from mycelia to spherules in C. immitis. The application of advanced techniques such as capped small (cs)RNA-seq, which identifies actively initiated stable and unstable transcripts, could provide insights into the regulatory networks involving CBP4 .

Protein Interaction Studies

Identifying protein-protein interactions involving CBP4 could elucidate its role in fungal biology and potentially reveal new targets for antifungal drug development. Techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling could be employed to map the interaction network of CBP4 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CBP4; CIMG_10084; Assembly factor CBP4; Cytochrome b mRNA-processing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Coccidioides immitis (strain RS) (Valley fever fungus)
Target Names
CBP4
Target Protein Sequence
MGSAWKWTKMITVGAVVCVGGPMFVNYVRPTEEELFQRFNPELQKRNLANRDKRQQEFDE FVTKLKEYSKSDKPIWVVAKEAEELQKKQQREAALAAKKAAAETPTDKPTQ
Uniprot No.

Target Background

Function

Essential for the assembly of ubiquinol-cytochrome c reductase. It directly influences the correct incorporation of the Rieske protein, core 4, core 5, and apocytochrome b.

Database Links
Protein Families
CBP4 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

How is CBP4 expressed in different growth phases of Coccidioides immitis?

Gene expression analysis indicates that many genes in C. immitis exhibit differential expression between the saprobic (hyphal) and parasitic (spherule) growth phases. While specific CBP4 expression data is not explicitly detailed in the provided studies, the comparative transcriptomics approach used by researchers has identified 1,298 genes up-regulated in the saprobic phase and 1,880 genes up-regulated in the parasitic phase across both C. immitis and C. posadasii .

To determine CBP4's specific expression pattern, researchers typically use RNA-seq analysis of actively-growing hyphae (saprobic phase) and pre-endosporulation spherules (parasitic phase) cultured for 96 hours in vitro. This methodology allows for the identification of genes potentially involved in the dimorphic transition, which is critical for pathogenesis .

What genomic and protein characteristics distinguish CBP4 in Coccidioides species?

The CBP4 gene in C. immitis is located in the genome with ORF name CIMG_10084 . The protein contains specific domains characteristic of assembly factors and has a predicted molecular function related to mitochondrial transcript processing.

In the context of the Coccidioides genome:

  • C. immitis RS genome has been fully sequenced and assembled into seven contigs, totaling 28.9 Mb with 10,355 annotated genes

  • The genomic context is important, as the GC content of regions can affect gene expression, with repetitive regions having 14-15% lower GC content than non-repetitive sequences

What are the optimal conditions for expression and purification of recombinant CBP4?

For the production of recombinant CBP4 protein:

  • Expression System Selection: While specific conditions for CBP4 aren't detailed in the search results, recombinant proteins from C. immitis are typically expressed in bacterial systems like E. coli or eukaryotic systems depending on the requirement for post-translational modifications .

  • Purification Protocol:

    • The recombinant protein is typically stored in Tris-based buffer with 50% glycerol

    • Optimal storage conditions include -20°C for standard storage and -80°C for extended storage

    • Working aliquots can be maintained at 4°C for up to one week

    • Repeated freezing and thawing should be avoided to maintain protein integrity

  • Tag Selection: The tag type for the recombinant protein will be determined during the production process and should be optimized based on the specific experimental requirements .

How can researchers validate the functionality of recombinant CBP4 in experimental settings?

To validate recombinant CBP4 functionality:

  • Structural Validation:

    • Confirm protein identity through mass spectrometry

    • Verify protein folding using circular dichroism or limited proteolysis

    • Use size exclusion chromatography to assess oligomerization state

  • Functional Assays:

    • Develop in vitro assays to measure cytochrome b mRNA processing activity

    • Assess binding interactions with target RNAs using electrophoretic mobility shift assays

    • Compare activity with native protein isolated from C. immitis if possible

  • Cellular Complementation:

    • Test the ability of recombinant CBP4 to complement function in CBP4-knockout models

    • Assess restoration of phenotypes in mutant strains

The validation approach should incorporate controls that account for potential differences between recombinant and native proteins, particularly regarding post-translational modifications.

How does CBP4 differ between C. immitis and C. posadasii at the genomic and protein levels?

Comparative analysis of C. immitis and C. posadasii genomes reveals:

  • Genomic Context:

    • Both species have similar genome sizes (C. immitis RS: 28.9 Mb, C. posadasii C735: 27 Mb)

    • Despite similar genome sizes, there are differences in annotated genes (C. immitis: 10,355, C. posadasii: 7,229)

    • Of the non-repetitive sequence, 93.5% exhibits homology between species with a median sequence identity of 98.3%

  • Species-Specific Genes:

    • Analysis identified 282 C. immitis-specific genes and 66 C. posadasii-specific genes

    • CBP4 appears to be conserved between species rather than species-specific

  • Evolutionary Patterns:

    • Comparative genomics suggests that the two species diverged approximately 5 million years ago

    • Introgression (genetic material exchange) has occurred between species, affecting gene expression patterns

Understanding these differences is crucial for interpreting CBP4 function in the context of both species and their pathogenic potential.

What role might CBP4 play in the evolutionary divergence of Coccidioides species?

The evolutionary significance of CBP4 can be analyzed through several lenses:

  • Conservation Pattern:

    • If CBP4 is highly conserved between species, it likely serves a fundamental cellular function

    • Conservation across Coccidioides species suggests evolutionary pressure to maintain this function

  • Introgression Analysis:

    • Studies have identified introgressed regions between C. immitis and C. posadasii, where genetic material has been exchanged

    • Analysis of whether CBP4 falls within these introgressed regions could provide insights into its evolutionary history

  • Selection Pressure:

    • Comparative transcriptomics has revealed genes under positive selection between growth phases

    • Determining whether CBP4 shows evidence of positive selection could indicate adaptive evolution

  • Transposable Element Influence:

    • Transposable elements affect gene expression in Coccidioides spp.

    • Genes near transposable elements like Gypsy or hAT show reduced expression, particularly in C. immitis

    • Analysis of the genomic context of CBP4 relative to transposable elements could provide insights into its regulation

How can CRISPR/Cas9 technology be applied to study CBP4 function in Coccidioides?

Recent advances in CRISPR/Cas9 technology for Coccidioides provide a methodology framework:

  • Double-Cut CRISPR/Cas9 Approach:

    • A successful double-cut CRISPR/Cas9 method has been developed for gene deletion in C. posadasii

    • This system overcomes previous limitations in genetic manipulation of Coccidioides

  • Implementation Strategy:

    • Design guide RNAs targeting regions flanking the CBP4 gene

    • Create a repair template containing a selectable marker (e.g., hygromycin resistance gene) with homology arms

    • Assemble CRISPR/Cas9 components in vitro before transformation

    • Transform C. immitis protoplasts with the assembled components

    • Select transformants on hygromycin-containing media

  • Validation Methods:

    • Confirm gene deletion using PCR with primers flanking the target region

    • Verify deletion using Southern blot analysis

    • Analyze phenotypic changes in both saprobic and parasitic growth phases

This approach would allow for the characterization of CBP4's role in C. immitis biology and potentially identify its contribution to pathogenesis .

What insights can transcriptomic approaches provide about CBP4's role during phase transition?

Transcriptomic analysis offers powerful insights into CBP4 function during the dimorphic transition:

  • RNA-seq Analysis:

    • Comparative transcriptomics between saprobic and parasitic phases can position CBP4 within the broader context of phase-specific gene expression

    • Analysis of co-expressed genes can suggest functional associations and regulatory networks involving CBP4

  • csRNA-seq Approach:

    • Capped small RNA sequencing (csRNA-seq) has been used to identify transcription start regions (TSRs) in C. immitis

    • This technique reveals alternative promoter usage and regulatory mechanisms associated with pathogenic growth

    • Application to CBP4 could identify its transcription start sites and regulatory elements

  • Methodology Framework:

    • Isolate RNA from different growth phases: mycelia (saprobic) and spherules (parasitic)

    • Perform csRNA-seq to identify TSRs associated with CBP4

    • Analyze bidirectional transcription and promoter architecture

    • Identify putative transcription factors regulating CBP4 expression

This approach would provide insights into the regulatory mechanisms controlling CBP4 expression during the critical transition from environmental to pathogenic growth .

How might CBP4 contribute to C. immitis pathogenesis and host adaptation?

Understanding CBP4's potential role in pathogenesis requires integrating multiple data types:

  • Mitochondrial Function Connection:

    • As a cytochrome b mRNA processing factor, CBP4 likely influences mitochondrial function

    • Mitochondrial activity is often reprogrammed during fungal pathogenesis to adapt to host environments

    • Changes in energy metabolism may support survival under host immune pressure

  • Expression Pattern Analysis:

    • If CBP4 shows differential expression between growth phases, this could suggest a specific role in adaptation to the host environment

    • Comparison with other known virulence factors could position CBP4 within pathogenicity pathways

  • Host Response Considerations:

    • Research in mouse models has shown that C. immitis and C. posadasii infection triggers specific cytokine responses

    • Correlating CBP4 expression with host immune responses could reveal its significance in pathogen-host interactions

  • Integration with Volatile Organic Compound (VOC) Analysis:

    • Recent studies have identified VOC patterns specific to Coccidioides infection

    • Investigating whether CBP4 influences the production of these compounds could link it to host recognition and response mechanisms

What comparative data exists on transposable elements affecting gene expression in Coccidioides species?

TE TypeC. immitisC. posadasii
NumberMean LengthNumberMean Length
DNA/TcMar286884575991
DNA/hAT1002416371232
LTR/Gypsy1204208911992046
LTR/Copia2871351190937
LINE36413312251237

Impact on Gene Expression:

  • In C. immitis, genes within 1 kB of Gypsy and hAT transposable elements show significantly reduced expression

  • Mean expression level of C. immitis genes within 1 kB of a TE is significantly lower (3.60 FPKM) compared to control genes (4.29 FPKM)

  • Genes near multiple TEs (four or more) show extremely low expression levels

  • This effect is less pronounced in C. posadasii, though still statistically significant for genes near Gypsy elements

Understanding these patterns is crucial when analyzing the genomic context of CBP4 and interpreting its expression data.

What are the key differences between C. immitis and C. posadasii genomes relevant to protein function studies?

FeatureC. immitis RSC. posadasii C735
Genome Size28.9 Mb27 Mb
Annotated Genes10,3557,229
Homologous Sequence22.3 Mb (93.5%)22.3 Mb
Species-Specific Genes28266
GC Content46% (average)46% (average)
GC Content in TEs28-39%28-39%
Repetitive DNA17-19% of genome17-19% of genome

Implications for Protein Studies:

  • Despite differences in annotated gene numbers, 9,996 C. immitis genes have BLASTN hits with >90% identity in C. posadasii

  • The differences in gene annotation are likely due to different annotation methodologies rather than actual biological differences

  • When studying proteins like CBP4, researchers should consider the high degree of similarity between species, while accounting for potential species-specific variations

This comparative data provides essential context for researchers studying C. immitis proteins, helping to interpret cross-species conservation and divergence.

What emerging technologies could enhance our understanding of CBP4 function?

Several cutting-edge approaches could advance CBP4 research:

  • Cryo-EM Structural Analysis:

    • Determining the three-dimensional structure of CBP4 alone and in complex with its RNA targets

    • Revealing mechanistic insights into how CBP4 interacts with cytochrome b mRNA

  • Single-Cell Transcriptomics:

    • Analyzing CBP4 expression at the single-cell level during the dimorphic transition

    • Identifying cell-to-cell variation in expression patterns that might be missed in bulk analyses

  • Proximity Labeling Proteomics:

    • Using BioID or APEX2 fusions with CBP4 to identify interacting protein partners

    • Mapping the protein interaction network to place CBP4 in its functional context

  • CRISPR Interference/Activation:

    • Using CRISPRi/CRISPRa to modulate CBP4 expression without complete gene deletion

    • Studying dose-dependent effects on mitochondrial function and pathogenesis

These approaches would complement existing methodologies and provide more nuanced understanding of CBP4's role in C. immitis biology.

How might host-pathogen interaction studies inform our understanding of CBP4's role in virulence?

Host-pathogen interaction studies could reveal new dimensions of CBP4 function:

  • Infection Models:

    • Mouse models have been used to study Coccidioides infection and immune responses

    • Comparing infection outcomes between wild-type and CBP4-modified strains could reveal its contribution to virulence

    • Analysis of bronchoalveolar lavage fluid (BALF) from infected mice could identify host responses specific to CBP4

  • Immune Recognition:

    • Investigating whether CBP4 is recognized by host immune receptors

    • Analyzing whether it triggers specific cytokine responses

  • Comparative Virulence:

    • Recent studies have shown differences in virulence between C. immitis and C. posadasii strains

    • Comparing CBP4 sequence, expression, and function between strains of varying virulence could reveal its significance

  • Volatile Organic Compound (VOC) Analysis:

    • Correlating CBP4 expression or mutation with changes in the volatilome

    • Determining whether CBP4-dependent metabolic changes influence host recognition

These approaches would position CBP4 within the broader context of C. immitis pathogenesis and potentially identify new therapeutic targets.

What quality control measures are essential when working with recombinant CBP4?

Ensuring the quality and consistency of recombinant CBP4 preparations requires:

  • Purity Assessment:

    • SDS-PAGE with Coomassie staining to verify protein size and purity

    • Western blot with tag-specific or CBP4-specific antibodies for identity confirmation

    • Mass spectrometry for accurate molecular weight determination and sequence verification

  • Structural Integrity:

    • Circular dichroism to assess secondary structure elements

    • Dynamic light scattering to evaluate homogeneity and aggregation state

    • Limited proteolysis to verify domain folding

  • Storage Stability:

    • The protein should be stored in Tris-based buffer with 50% glycerol

    • Maintain at -20°C for standard storage or -80°C for extended periods

    • Working aliquots can be kept at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Functional Activity:

    • Develop and validate assays for cytochrome b mRNA processing activity

    • Include positive controls from related proteins with known activity

    • Establish dose-response relationships to ensure activity is proportional to protein concentration

These measures ensure that experimental results accurately reflect CBP4 biology rather than artifacts of protein preparation.

What are the key considerations for designing gene expression studies involving CBP4?

When designing gene expression studies focusing on CBP4:

  • Growth Phase Selection:

    • Culture C. immitis in both saprobic (hyphal) and parasitic (spherule) phases

    • For parasitic phase, use pre-endosporulation spherules cultured for 96 hours

    • For saprobic phase, use actively-growing hyphae

  • RNA Extraction Optimization:

    • Develop protocols that efficiently lyse both hyphal and spherule forms

    • Ensure RNA integrity is maintained throughout the extraction process

    • Include DNase treatment to remove genomic DNA contamination

  • Expression Analysis Approaches:

    • RNA-seq for comprehensive transcriptome analysis

    • csRNA-seq to identify transcription start regions and regulatory elements

    • RT-qPCR for targeted validation of specific expression changes

  • Data Analysis Considerations:

    • Account for the genomic context of CBP4, particularly its proximity to transposable elements

    • Consider both absolute expression levels and relative changes between conditions

    • Use appropriate normalization methods to account for differences in RNA composition between growth phases

These methodological considerations ensure robust and reproducible gene expression data for CBP4 in different biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.