Recombinant Coccidioides immitis Cytochrome c oxidase assembly protein COX16, mitochondrial (COX16)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase (COX), also known as complex IV of the mitochondrial respiratory chain, is essential for producing ATP, the primary energy source for cellular functions . COX16 is a protein required for the biogenesis of cytochrome c oxidase . It is involved in the assembly of the mitochondrial respiratory chain complex IV (CIV) .

Structure and Localization

COX16 is a conserved protein initially identified in yeast as required for cytochrome c oxidase biogenesis . In Saccharomyces cerevisiae, Cox16 is an integral inner-membrane protein with a mitochondrial targeting sequence at the N-terminus . Human COX16 lacks a predictable N-terminal presequence . Human COX16 encodes a small mitochondrial transmembrane protein that faces the intermembrane space and is highly expressed in skeletal and cardiac muscle .

Function

COX16 assists in copper insertion into COX2 and has a second function. It interacts specifically with newly synthesized COX2 and its copper center-forming metallochaperones SCO1, SCO2, and COA6 . COX16 is required for SCO1, but not SCO2, association with COX2, which implicates COX16 in CuA site formation . Patient-mimicking amino acid exchanges in SCO1 and COA6 impact COX16 association with these metallochaperones . COX16 facilitates COX2 association with the MITRAC assembly intermediate containing COX1 . COX16 participates in merging the COX1 and COX2 assembly lines .

Role in Cytochrome c Oxidase Assembly

COX16 is required for the assembly of cytochrome c oxidase in human cells and is involved in copper delivery to COX2 . COX16 is required for the formation of the COX2 subassembly module .

Impact of COX16 Deficiency

Ablation of COX16 in HEK293 cells impairs COX assembly . COX16 knockout cells retain significant COX activity, suggesting that the function of COX16 is partially redundant . In COX16 knockout cells, the cytochrome c oxidase amount is reduced to approximately 50% compared to the wild-type control, which directly correlates with the reduction of complex IV activity to approximately 65% .

COX16 and Copper Delivery

Copper supplementation increases COX activity and restores normal steady-state levels of COX subunits in COX16 knockout cells, indicating that COX16 could be involved in copper delivery to COX2, even in the absence of a canonical copper-binding motif .

COX16 Interaction with COX2

COX16 solely associates with newly synthesized COX2 and is involved in the biogenesis of the COX2 assembly module . COX2 association with MITRAC12 or C12ORF62 is drastically affected by the absence of COX16 . COX16 facilitates the assembly of COX2-containing assembly modules to the COX1-containing MITRAC complexes, possibly together with MITRAC12 .

Data Table

FeatureDescription
Gene NameCOX16
Protein NameCytochrome c oxidase assembly protein COX16, mitochondrial
LocalizationMitochondrial inner membrane
FunctionAssists in copper insertion into COX2, facilitates COX2 association with MITRAC assembly intermediate, involved in merging the COX1 and COX2 assembly lines
Role in COX AssemblyRequired for the assembly of cytochrome c oxidase, involved in copper delivery to COX2
Impact of DeficiencyImpaired COX assembly, reduced COX activity, affects COX2 stability
InteractionInteracts with newly synthesized COX2, metallochaperones SCO1, SCO2, and COA6, facilitates assembly of COX2-containing assembly modules to the COX1-containing MITRAC complexes
Copper DeliveryInvolved in copper delivery to COX2
ExpressionHighly expressed in skeletal and cardiac muscle
OrganismCoccidioides immitis
CodeCSB-CF625595DUV

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
COX16; CIMG_08520; Cytochrome c oxidase assembly protein COX16, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-137
Protein Length
Full Length of Mature Protein
Species
Coccidioides immitis (strain RS) (Valley fever fungus)
Target Names
COX16
Target Protein Sequence
STSAGSTLGDRIGQMYRAHLSKHPFLLFGLPFLSLMVAGSFVLTPATALRYERHDRKVQQ VSQQEALALGIKGPDGDGENDIKMNPRRRVLGSEKEEYYRLMAKDLDNWEQKRVQRWKGE PDGRLS
Uniprot No.

Target Background

Function

Essential for the assembly of mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. It may play a role in the convergence of the COX1 and COX2 assembly pathways.

Database Links
Protein Families
COX16 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

How is COX16 characterized structurally in eukaryotic cells?

COX16 is characterized as an inner mitochondrial membrane protein with a predicted single transmembrane span. Structural analyses have shown that COX16 is resistant to carbonate extraction, confirming its identity as an integral membrane protein . Its topology places the C-terminus facing the intermembrane space (IMS) . This membrane localization is critical for its function, as it allows COX16 to interact with both matrix-sided and IMS-sided assembly factors in the cytochrome c oxidase assembly pathway.

What evidence exists for COX16's clinical significance?

Clinical studies have identified homozygous nonsense variants in COX16 (specifically c.244C>T(p. Arg82*)) in patients presenting with hypertrophic cardiomyopathy, encephalopathy, and severe fatal lactic acidosis, associated with isolated complex IV deficiency . These findings establish COX16 deficiency as a cause of mitochondrial disease with severe clinical manifestations. Importantly, lentiviral transduction of patient fibroblasts with wild-type COX16 cDNA rescued complex IV biosynthesis, providing definitive evidence for the pathogenicity of COX16 mutations .

What expression systems are optimal for producing recombinant Coccidioides immitis COX16?

For recombinant expression of C. immitis COX16, researchers should consider eukaryotic expression systems that can properly process mitochondrial proteins. Based on successful approaches with other COX16 homologs, yeast expression systems (particularly Saccharomyces cerevisiae) offer advantages for proper folding and mitochondrial targeting. A dual-tagging strategy, such as polyhistidine and protein C tags, has proven effective for isolation and characterization of Cox16p in yeast studies . For higher yields, insect cell expression systems can be considered, though proper mitochondrial targeting signals may need optimization.

What purification challenges should researchers anticipate when working with recombinant COX16?

Purification of recombinant COX16 presents several challenges due to its membrane-bound nature. Researchers should anticipate:

  • Requirement for appropriate detergents to solubilize the protein while maintaining native conformation

  • Need for careful optimization of extraction conditions to maintain protein-protein interactions

  • Potential co-purification of native mitochondrial complex components

  • Difficulty in achieving high yields due to the relatively low abundance of assembly factors

Published studies have successfully used co-immunopurification approaches with tagged versions of COX16 to study its interactions, suggesting this as a viable strategy .

How can researchers validate the functional activity of recombinant COX16?

Functional validation should follow a multi-faceted approach:

  • Complementation studies in COX16-deficient cells or organisms to rescue complex IV deficiency

  • Measurement of cytochrome c oxidase activity through spectrophotometric assays

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) with in-gel activity staining to assess complex IV assembly

  • Oxygen consumption rate measurements to evaluate respiratory chain function

  • Co-immunoprecipitation assays to verify interactions with known partners

Studies have shown that absence of COX16 leads to approximately 50% reduction in cytochrome c oxidase levels and 65% reduction in complex IV activity compared to wild-type controls . These parameters provide quantifiable metrics for functional validation.

What is the specific role of COX16 in copper delivery to complex IV?

Evidence suggests that COX16 functions within the copper delivery pathway for the formation of the CuA center in COX2. Research has shown that COX16 interacts with the copper chaperones SCO1, SCO2, and COA6, which are critical for copper delivery to COX2 . The recruitment of SCO1 to the COX2-module has been demonstrated to be COX16-dependent, and patient-mimicking mutations in SCO1 affect interaction with COX16 . These findings implicate COX16 in the Cu A-site formation pathway. Future research should investigate the precise biochemical mechanism by which COX16 facilitates copper incorporation, potentially through structural studies and in vitro reconstitution experiments.

How does COX16 coordinate assembly between different respiratory complex modules?

Research indicates that COX16 plays a dual role in cytochrome c oxidase assembly by participating in both COX2 module formation and facilitating the merger of assembly lines. Studies have shown that COX16 is surprisingly found in COX1-containing assembly intermediates and is involved in COX2 recruitment to COX1 . This suggests that COX16 functions as a molecular bridge between different assembly modules. Research using proximity labeling techniques or time-resolved proteomics could help elucidate the temporal sequence of these interactions and identify potential regulatory mechanisms governing this coordination.

What are the evolutionary implications of COX16 conservation across fungal species including pathogenic fungi?

The conservation of COX16 across diverse fungal species, including pathogenic fungi like Coccidioides immitis, suggests fundamental importance in mitochondrial function. Comparative genomic analyses could reveal selective pressures on COX16 in different fungal lineages and potentially identify pathogen-specific adaptations. Since Coccidioides species are dimorphic fungi that transition between environmental and parasitic forms , research should investigate whether COX16 function is differentially regulated during this transition, potentially reflecting metabolic adaptations during the infection process.

How might COX16 function relate to the pathogenicity of Coccidioides immitis?

Coccidioides immitis causes coccidioidomycosis (Valley fever), a respiratory infection that can disseminate to other organs . While direct evidence linking COX16 to pathogenicity is limited, mitochondrial function is critical for fungal virulence. Research should explore:

  • Whether COX16 expression changes during the transition from environmental arthroconidia to parasitic spherules

  • If COX16 function affects resistance to host immune defenses, particularly oxidative stress

  • Whether mitochondrial metabolism influences known virulence factors

Approximately 60% of Coccidioides infections are subclinical or mild, while about 30% cause pneumonia-like symptoms and 10% develop severe complications . Understanding whether mitochondrial function influences this spectrum of disease severity represents an important research direction.

What methodological approaches are most suitable for studying COX16 in the context of Coccidioides infection models?

Given the biosafety concerns associated with Coccidioides immitis (BSL-3 pathogen), researchers should consider:

  • Development of conditional knockdown systems to study COX16 function in vitro

  • Heterologous expression in less pathogenic fungi to study conserved functions

  • Mouse models of coccidioidomycosis with readouts for mitochondrial function

  • Ex vivo infection models using human or animal respiratory epithelial cells

  • Transcriptomic and proteomic analyses of different infection stages

These approaches should be designed to address the specific challenges of working with a respiratory pathogen while enabling detailed molecular analysis of mitochondrial assembly factors.

How do environmental factors influence COX16 expression and function in Coccidioides immitis?

Coccidioides immitis inhabits arid soils and is transmitted through inhalation of arthroconidia carried by dust storms . Research should investigate how environmental stressors affect COX16 expression and function:

  • Temperature shifts that occur during host infection

  • Nutrient limitation encountered in host tissues

  • pH changes in different anatomical sites

  • Oxygen availability variations between environmental and host niches

Understanding these adaptations could provide insights into how this fungal pathogen modulates its energy metabolism during infection processes.

What are the appropriate controls when studying recombinant COX16 in heterologous systems?

When working with recombinant Coccidioides immitis COX16 in heterologous systems, researchers should implement:

  • Empty vector controls to account for expression system effects

  • Wild-type COX16 from the expression host organism as a functional reference

  • Known COX16 mutants with characterized phenotypes as comparators

  • Additional cytochrome c oxidase assembly factors as specificity controls

  • Mitochondrial targeting sequence optimization controls

These controls help distinguish between effects specific to C. immitis COX16 and artifacts of the expression system.

How should researchers approach conflicting data regarding COX16 function across different model systems?

When encountering conflicting data across different experimental systems:

  • Systematically compare methodological differences (detergents, tags, expression levels)

  • Consider species-specific differences in mitochondrial assembly pathways

  • Validate key findings using multiple complementary techniques

  • Perform direct side-by-side comparisons using standardized conditions

  • Develop a consensus model that accounts for context-dependent functions

Studies have shown that COX16 knockout in human cells leads to severe reduction of cytochrome c oxidase , while findings in yeast suggest associations with assembly intermediates . These potentially different phenotypes highlight the importance of considering evolutionary divergence when interpreting data from different systems.

What bioinformatic approaches can identify functionally important domains in Coccidioides immitis COX16?

To identify functionally important domains in C. immitis COX16, researchers should employ:

  • Multiple sequence alignment across diverse fungi and other eukaryotes

  • Structural prediction algorithms focused on membrane protein topology

  • Conservation analysis to identify residues under evolutionary constraint

  • Co-evolution analysis to identify potential interaction interfaces

  • Comparison with known disease-causing mutations in human COX16

These approaches can guide experimental design for site-directed mutagenesis studies and help interpret the functional significance of sequence variations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.