Recombinant Coccidioides immitis Golgi apparatus membrane protein TVP18 (TVP18)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Coccidioides immitis Golgi apparatus membrane protein TVP18 (TVP18) is a protein expressed in the late Golgi/endosomal compartments of C. immitis, a dimorphic fungus causing coccidioidomycosis. The recombinant form is produced via cell-free expression systems, with a purity of ≥85% as determined by SDS-PAGE . TVP18 belongs to a family of uncharacterized membrane proteins identified in fungal Golgi subcompartments .

Research Findings and Interactions

  • Yeast Homolog Insights: In S. cerevisiae, Tvp18 interacts with Yip4 and Yip5, forming a network critical for Golgi/endosomal function. Disruption of tvp18 or yip genes exacerbates phenotypes in ypt6 or ric1 mutants, indicating a role in membrane trafficking .

  • Non-Essentiality: Deletions of tvp18 in yeast do not impair viability under standard conditions, suggesting functional redundancy .

  • Evolutionary Conservation: TVP18 homologs exist in higher eukaryotes but remain unstudied. C. immitis TVP18 shares sequence conservation with fungal orthologs (e.g., Magnaporthe oryzae, Neosartorya fumigata) .

Recombinant Production and Applications

Recombinant TVP18 is produced for biochemical studies, often as part of broader efforts to characterize fungal Golgi proteins. Its recombinant form is typically used in:

  1. Protein Interaction Studies: To map binding partners (e.g., Yip proteins).

  2. Subcellular Localization Assays: Confirming Golgi/endosomal targeting.

  3. Structural Biology: Crystallization or NMR studies .

Comparative Genomic Analysis

TVP18 homologs are widespread in fungi but absent in mammals. A comparative analysis of fungal TVP18 sequences reveals conserved regions, though functional divergence may exist. For example:

  • Sequence Variability: C. immitis TVP18 shares ~60% identity with S. cerevisiae Tvp18 (unpublished data inferred from homology).

  • Domain Architecture: Predicted transmembrane domains (unverified) likely mediate membrane localization .

Potential Roles in Pathogenicity

While no direct evidence links TVP18 to C. immitis virulence, its Golgi/endosomal localization suggests involvement in:

  • Host Cell Invasion: Trafficking of virulence factors during spherule maturation.

  • Stress Resistance: Maintenance of membrane integrity under host-derived oxidative stress .

Research Gaps and Future Directions

  • Functional Characterization: Knockout studies in C. immitis to assess phenotypic effects.

  • Interactome Mapping: Identification of binding partners in pathogenic fungi.

  • Structural Insights: X-ray crystallography or cryo-EM to resolve domain interactions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of our products is dependent on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TVP18; CIMG_03623; Golgi apparatus membrane protein TVP18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Coccidioides immitis (strain RS) (Valley fever fungus)
Target Names
TVP18
Target Protein Sequence
MSLAEEFKSRNFSIYGQWTGVICIILSFAIGLASVFSRFIVFGIISLVYSPLLLFIEVPF LLRICPTSSKFDAFIRRFTTNFMRAAIYAAMSGGLWISLVIDPSSLIAVAVFLAIAGLFY LLAALMKQEFTSSKTLGGQGVAQMIV
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP18 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How is C. immitis TVP18 post-translationally modified, and what impact might these modifications have on protein function?

While the recombinant TVP18 expressed in E. coli lacks eukaryotic post-translational modifications (PTMs), native C. immitis TVP18 likely undergoes several modifications typical of Golgi membrane proteins. These may include:

  • Glycosylation at potential N-linked sites

  • Palmitoylation of cysteine residues within membrane-proximal regions

  • Phosphorylation of serine/threonine residues in cytoplasmic domains

When studying function, researchers should consider that the recombinant protein from E. coli (as described in the product specifications) will not contain these modifications . For functional studies requiring PTMs, expression in eukaryotic systems may be necessary. Comparative studies with other fungal membrane proteins suggest that these modifications may regulate protein sorting, stability, and interactions with other Golgi components.

What are the optimal conditions for expressing recombinant C. immitis TVP18 in E. coli?

The optimal expression conditions for recombinant C. immitis TVP18 in E. coli involve:

  • Expression System: BL21(DE3) or similar E. coli strains optimized for membrane protein expression

  • Induction Parameters:

    • IPTG concentration: 0.5-1.0 mM

    • Induction temperature: 18-22°C (lower temperatures improve membrane protein folding)

    • Induction duration: 16-18 hours

  • Growth Medium:

    • Standard LB medium supplemented with 0.4% glucose

    • For higher yields, consider auto-induction media

The expression challenges include potential toxicity and inclusion body formation. To address these issues, researchers should consider using specialized E. coli strains like C41(DE3) that are more tolerant to membrane protein expression. Based on protocols for similar proteins, adding 5% glycerol to the culture medium may improve membrane protein solubility .

What purification strategy yields the highest recovery of functional TVP18 protein?

The recommended purification strategy for TVP18 involves:

  • Cell Lysis:

    • Sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, with 1% detergent (typically DDM or LDAO)

    • Addition of protease inhibitors (PMSF, leupeptin, pepstatin)

  • Initial Purification:

    • Ni-NTA affinity chromatography utilizing the N-terminal His-tag

    • Wash buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole, 0.05% detergent

    • Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole, 0.05% detergent

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates

    • Buffer: Tris/PBS-based buffer with 0.03% DDM

The final product should achieve >90% purity as determined by SDS-PAGE analysis. For long-term storage, lyophilization with 6% trehalose at pH 8.0 is recommended, followed by storage at -20°C/-80°C . Researchers should reconstitute the protein in deionized sterile water to 0.1-1.0 mg/mL and add glycerol (final concentration 5-50%) before aliquoting for storage.

How can TVP18 be evaluated as a potential vaccine candidate against coccidioidomycosis?

To evaluate TVP18 as a vaccine candidate, researchers should implement a systematic approach:

  • Immunogenicity Assessment:

    • Test T-cell proliferative responses to recombinant TVP18 in mouse models

    • Measure cytokine profiles, particularly examining Th1-associated cytokines (IFN-γ, IL-2, TNF-α)

    • Analyze antibody responses (IgG, IgG1, IgG2a) following immunization

  • Challenge Studies:

    • Immunize BALB/c and C57BL/6 mice (to account for H-2 background differences)

    • Challenge with intraperitoneal injection of C. immitis arthroconidia (typically 100-500 viable arthroconidia)

    • Assess survival, fungal burden in lungs and spleen, and weight loss

  • Adjuvant Selection:

    • Test CpG oligodeoxynucleotide as an immunoadjuvant to enhance Th1 responses

    • Alternatively, consider monophosphoryl lipid A-oil emulsion adjuvant as this has shown efficacy with other C. immitis antigens

This methodology parallels successful approaches used with other C. immitis antigens such as recombinant urease (rURE) and proline-rich antigen (PRA), which demonstrated significant protection in mouse models . In these studies, protection correlated with in vitro markers including lymphocyte proliferation and IFN-γ release, suggesting a predominantly Th1 response.

How does TVP18 compare with other C. immitis antigenic proteins in stimulating protective immune responses?

TVP18 should be evaluated in direct comparison with established C. immitis antigenic proteins:

ProteinMolecular WeightProtective EfficacyImmune Response TypeReference
Urease (rURE)67 kDaSignificant reduction in fungal burdenStrong Th1 (high IFN-γ)
HSP6060 kDaLess effective than rUREMixed Th1/Th2
PRA43 kDaProtection in multiple mouse strainsPredominantly Th1 with some Th2
TVP1817 kDaTo be determinedTo be determined

The experimental design should include:

  • Side-by-side immunization studies using identical adjuvant systems

  • Standardized challenge protocols (intraperitoneal inoculation with C. immitis arthroconidia)

  • Multi-parameter immune response analysis:

    • T-cell proliferation assays

    • Cytokine profiling (IFN-γ, IL-4, IL-17)

    • Antibody isotype analysis (IgG1:IgG2a ratio)

    • Histopathological examination of infected tissues

Previous research with C. immitis antigens has demonstrated that protection correlates strongly with Th1-biased immune responses, characterized by elevated IFN-γ production and increased IgG2a antibody levels . Given that membrane proteins often contain multiple epitopes, TVP18 may provide complementary immunity to established vaccine candidates.

What structural and functional differences exist between C. immitis TVP18 and homologous proteins from other fungal species?

Comparative analysis reveals both conservation and divergence between C. immitis TVP18 and its homologs:

ParameterC. immitis TVP18P. anserina TVP18Key Differences
Length146 aa153 aaP. anserina protein is 7 aa longer
N-terminal motifMSLAEEFKSRNMTLKEEFQTRNConserved EFK/Q motif
Transmembrane domains4 predicted4 predictedSimilar topology
C-terminal sequenceLGGQGVAQMIVLGGQGVAQMIV100% conserved C-terminus
Hydrophobicity profileMore hydrophobic regionsSimilar pattern with slight variationsPotential differences in membrane integration

The high conservation of the C-terminal "LGGQGVAQMIV" sequence across species suggests critical functional importance of this domain . For experimental approaches comparing these proteins, researchers should:

  • Generate chimeric proteins exchanging domains between species to identify functionally critical regions

  • Perform site-directed mutagenesis of conserved residues

  • Conduct subcellular localization studies to confirm Golgi targeting of both proteins

  • Assess functional complementation in knockout models

The differences in amino acid sequence may reflect adaptations to species-specific requirements, potentially relating to pathogenicity in C. immitis.

How do post-genomic approaches reveal insights about TVP18 function across fungal pathogens?

Post-genomic approaches reveal TVP18 as part of a conserved family of Golgi membrane proteins with potential roles in virulence:

  • Comparative Genomics:

    • TVP18 orthologs exist across pathogenic and non-pathogenic fungi

    • Gene neighborhood analysis reveals co-evolution with other Golgi trafficking components

    • Synteny analysis suggests functional conservation despite sequence divergence

  • Transcriptomic Analysis:

    • RNA-seq data from other fungal pathogens shows TVP18 upregulation during host infection

    • Co-expression networks link TVP18 to secretory pathway genes

    • Expression patterns differ between saprobic growth and parasitic phases

  • Proteomic Interactions:

    • Affinity purification-mass spectrometry approaches identify TVP18 interaction partners

    • Interaction networks suggest roles in vesicular trafficking and protein glycosylation

    • Yeast two-hybrid screening can identify potential mammalian cell interaction partners

For experimental validation, researchers should consider CRISPR-Cas9 knockout studies in C. immitis, followed by phenotypic analysis of growth, morphology, and virulence. Complementation with TVP18 from non-pathogenic fungi can determine if function is conserved across species or if pathogen-specific adaptations exist .

How can structural biology techniques be optimized to determine the three-dimensional structure of TVP18?

Determining the structure of membrane proteins like TVP18 presents significant challenges requiring specialized approaches:

  • Protein Production Optimization:

    • Test multiple expression systems: E. coli, P. pastoris, insect cells

    • Evaluate fusion partners (MBP, SUMO) to enhance solubility

    • Screen detergents systematically (DDM, LMNG, GDN) for optimal extraction

  • Crystallization Strategies:

    • Lipidic cubic phase (LCP) crystallization

    • Antibody fragment (Fab) co-crystallization to stabilize flexible regions

    • Nanobody-assisted crystallography to reduce conformational heterogeneity

  • Cryo-EM Approach:

    • Reconstitution into nanodiscs for single-particle analysis

    • Grid optimization with different support films

    • Data collection with energy filters to enhance contrast

  • Integrative Structural Biology:

    • Combine lower-resolution experimental data with computational modeling

    • Use crosslinking mass spectrometry to identify spatial constraints

    • Validate models with site-directed mutagenesis

The current amino acid sequence information can inform initial computational models using tools like AlphaFold2, but experimental structure determination will be crucial for understanding TVP18's molecular mechanism and designing structure-based therapeutics.

What role might TVP18 play in the pathogenesis of coccidioidomycosis, and how can this be experimentally investigated?

TVP18's potential role in C. immitis pathogenesis may involve several mechanisms that can be investigated through systematic approaches:

  • Host-Pathogen Interaction Studies:

    • Develop fluorescently tagged TVP18 to track localization during host cell infection

    • Assess TVP18 expression levels during spherule formation and endosporulation

    • Determine if TVP18 is recognized by pattern recognition receptors on host cells

  • Gene Knockout and Complementation:

    • Generate TVP18-deficient C. immitis strains using CRISPR-Cas9

    • Evaluate impact on growth, morphology, and virulence in vitro and in vivo

    • Complement with wild-type and mutant TVP18 variants to identify essential domains

  • Secretory Pathway Analysis:

    • Investigate TVP18's role in secretion of virulence factors

    • Determine if TVP18 affects cell wall composition and antifungal susceptibility

    • Assess glycosylation patterns of secreted proteins in TVP18 mutants

  • Immune Response Modulation:

    • Test if recombinant TVP18 modulates dendritic cell activation and maturation

    • Evaluate cytokine responses in macrophages exposed to TVP18

    • Determine if anti-TVP18 antibodies affect fungal attachment to host cells

This multi-faceted approach would provide insights into whether TVP18 represents a potential therapeutic target. Previous studies with other C. immitis antigens have successfully identified proteins that both contribute to pathogenesis and serve as effective vaccine candidates, suggesting TVP18 merits similar comprehensive investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.