Recombinant Coccidioides immitis Golgi apparatus membrane protein TVP23 (TVP23)

What is the molecular structure and basic characterization of C. immitis TVP23?

TVP23 is a transmembrane protein localized to the Golgi apparatus in Coccidioides immitis. The full-length protein consists of 188 amino acids with the sequence: MDQQRTGDLNWRLSAHPITLLFFLGFRIGSLLMYLFGVLFISDFVLVFILTLLLLSADFYYLKNIAGRRLVGLRWWNEVNTSTGDSNWVFESSDPNTRTINATDKRFFWLSLYATPALWIGLAILAIIRLQSVIWLSLVGIALILTVTNTLAFSRCDRFSQASTFASSALSGGITSNLTRGVFGRLFR . Based on its homology to other TVP23 family proteins, it likely contains multiple transmembrane domains that anchor it within the Golgi membrane. The protein appears to be conserved across fungal species, suggesting evolutionary importance in membrane trafficking pathways.

How does recombinant C. immitis TVP23 differ from its native form?

The recombinant form of C. immitis TVP23 available for research typically includes an N-terminal His tag to facilitate purification . While the native protein functions within the fungal Golgi apparatus membrane, the recombinant version is expressed in E. coli expression systems . This heterologous expression may result in differences in post-translational modifications compared to the native protein. When designing experiments, researchers should consider that the His-tag might influence protein folding or interaction dynamics. For applications requiring native-like function, validation experiments comparing tagged versus untagged versions may be necessary to ensure the tag does not interfere with relevant protein-protein interactions.

What is the biological significance of C. immitis and why is TVP23 research important?

Coccidioides immitis is a thermally dimorphic fungus that causes coccidioidomycosis (Valley Fever), an emerging endemic fungal infection with increasing incidence and expanding geographic range primarily in the southwestern United States and Mexico . Approximately 30% of infected individuals develop illness, with less than 1% progressing to disseminated disease . Understanding the molecular components of C. immitis, including Golgi proteins like TVP23, is critical for elucidating the pathogenesis mechanisms and developing targeted antifungal therapies. Research on TVP23 contributes to our broader understanding of the unique biology of this pathogen, particularly given that homologous proteins in other organisms (like TVP23B in mammals) play crucial roles in cellular homeostasis and host-microbe interactions .

What role might TVP23 play in C. immitis virulence and morphological transition?

Based on studies of TVP23 homologs in other organisms, C. immitis TVP23 likely plays a significant role in protein trafficking through the Golgi apparatus, which could be crucial during the fungal morphological transition from environmental mycelia to pathogenic spherules . In mammalian systems, the homologous protein TVP23B regulates intestinal homeostasis by controlling the function of secretory cells and antimicrobial peptide production . By analogy, C. immitis TVP23 may be involved in secretory pathways that facilitate adaptation during host infection. Researchers investigating TVP23's role in virulence should consider designing experiments that track protein localization during morphological transition using fluorescently-tagged constructs, combined with transcriptomic analysis to identify co-regulated genes during spherule formation.

How does C. immitis TVP23 compare with homologs in other fungal pathogens and model organisms?

While the search results don't provide direct comparative data for TVP23 across fungal species, they indicate that TVP23 homologs are conserved from yeast to humans . For effective comparative studies, researchers should perform phylogenetic analyses to determine evolutionary relationships and functional conservation. Key experimental approaches would include:

• Sequence alignment and domain prediction to identify conserved functional regions

• Complementation studies in model organisms (e.g., S. cerevisiae TVP23 mutants)

• Comparative localization studies to determine if subcellular positioning is conserved

The mammalian homolog TVP23B interacts with YIPF6 and influences glycosylation enzymes in the Golgi apparatus , suggesting researchers should investigate similar interactions in C. immitis. Understanding these relationships could reveal conserved mechanisms of membrane protein trafficking across the fungal kingdom.

What transcriptional regulatory mechanisms control TVP23 expression during different growth phases?

Recent studies using capped small RNA sequencing (csRNA-seq) have revealed massive transcriptional reprogramming during the mycelia-to-spherule transition in Coccidioides . While specific data on TVP23 regulation is not provided in the search results, the spherule transition involves large-scale changes in transcript isoforms and promoter-distal transcription of non-coding RNAs. Researchers investigating TVP23 regulation should consider applying csRNA-seq methodology to specifically track TVP23 transcription initiation sites during different growth phases.

Analysis of the TVP23 promoter region for WOPR family transcription factor binding motifs would be valuable, as these factors have been implicated in virulence regulation in Coccidioides and other fungi . CIMG_02671, identified as a C. immitis WOPR homolog, could potentially regulate TVP23 expression during pathogenic transition. Experimental verification through chromatin immunoprecipitation (ChIP) or reporter gene assays would confirm these regulatory relationships.

What are the optimal conditions for expression and purification of recombinant C. immitis TVP23?

Based on available data, recombinant C. immitis TVP23 can be successfully expressed in E. coli with an N-terminal His tag . The recommended protocol includes:

• Expression in E. coli using an appropriate vector containing the full-length (1-188 aa) TVP23 sequence

• Purification using nickel affinity chromatography targeting the His tag

• Buffer exchange to Tris/PBS-based buffer, pH 8.0, containing 6% trehalose

• Lyophilization for stable storage

For reconstitution, researchers should:

• Briefly centrifuge the vial before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended 50%)

• Aliquot for long-term storage at -20°C/-80°C

• Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week

Protein purity should exceed 90% as determined by SDS-PAGE . For membrane proteins like TVP23, researchers might need to optimize detergent conditions during purification to maintain native conformation.

What functional assays can be used to investigate TVP23's role in Golgi trafficking?

Drawing from studies on TVP23 homologs, several functional assays can be adapted to investigate C. immitis TVP23:

• Protein-Protein Interaction Studies: Co-immunoprecipitation or yeast two-hybrid assays to identify binding partners, particularly looking for interactions similar to the TVP23B-YIPF6 interaction observed in mammalian systems .

• Glycosylation Analysis: Since TVP23B influences glycosylation enzyme distribution in the Golgi, researchers should assess changes in protein glycosylation patterns in TVP23 mutant strains using mass spectrometry or lectin binding assays.

• Vesicle Trafficking Assays: Fluorescently labeled cargo proteins can be tracked to measure anterograde and retrograde trafficking through the Golgi in the presence or absence of functional TVP23.

• Conditional Knockout Studies: Given that direct gene deletion may be challenging if TVP23 is essential, conditional expression systems should be established to study loss-of-function effects during specific developmental stages.

• Localization Studies: Fluorescent protein tagging combined with confocal microscopy to track TVP23 positioning within the Golgi apparatus during different growth phases and in response to environmental stimuli.

How can researchers effectively generate and validate TVP23 knockout or mutant strains in C. immitis?

Generating gene-modified strains in pathogenic fungi like C. immitis presents unique challenges. Based on recent advances in molecular tools for Coccidioides , researchers should consider:

• CRISPR/Cas9 Targeting: Similar to the approach used for TVP23B in mice , CRISPR/Cas9 can generate frameshift mutations in TVP23. Target selection should focus on early exons to ensure complete loss of function.

• Conditional Systems: If TVP23 is essential, tetracycline-inducible or similar conditional expression systems should be employed.

• Validation Approaches:

  • RT-qPCR to confirm transcript reduction

  • Western blotting with anti-TVP23 antibodies to verify protein absence

  • Phenotypic characterization during different growth phases

  • Complementation with wild-type TVP23 to rescue mutant phenotypes

• Biosafety Considerations: All genetic manipulations must be performed under appropriate biosafety conditions given the pathogenic nature of C. immitis.

What potential role does TVP23 play in C. immitis pathogenesis based on homolog studies?

Studies of mammalian TVP23B provide insights into potential roles for C. immitis TVP23 in pathogenesis. In mammals, TVP23B controls the homeostasis of secretory cells and regulates mucin production and antimicrobial peptide secretion . By analogy, C. immitis TVP23 might regulate:

• Cell Wall Composition: Potentially influencing β-glucan exposure, which is critical for host immune recognition .

• Secretory Pathway Function: Controlling the trafficking of virulence factors or immune-modulating molecules during infection.

• Morphological Transition: Supporting the extensive membrane reorganization required during mycelia-to-spherule transition .

• Stress Response: Facilitating adaptation to the host environment through appropriate protein trafficking and secretion.

To investigate these possibilities, researchers should perform comparative proteomic analyses of wild-type versus TVP23-deficient strains under conditions mimicking the host environment, focusing on secreted proteins and cell wall components.

How might TVP23 interact with other proteins in the Golgi trafficking pathway of C. immitis?

Based on studies of TVP23 homologs, C. immitis TVP23 likely participates in a protein interaction network within the Golgi apparatus. The mammalian homolog TVP23B interacts with YIPF6, and both proteins are critical for maintaining proper distribution of glycosylation enzymes in the Golgi . Researchers investigating C. immitis TVP23 interactions should:

• Perform co-immunoprecipitation experiments followed by mass spectrometry to identify binding partners

• Create a Golgi proteome map to visualize the impact of TVP23 deficiency on protein distribution within the organelle

• Apply proximity labeling techniques (BioID or APEX) to identify the spatial interactome of TVP23 within the Golgi

• Search for C. immitis homologs of known TVP23B interactors (like YIPF6) and experimentally verify these interactions

Understanding these protein-protein interactions could reveal mechanisms by which TVP23 contributes to C. immitis virulence and identify potential targets for antifungal intervention.

What implications does TVP23 function have for antifungal drug development?

The Golgi apparatus represents an underexplored target for antifungal therapies. Given the potential role of TVP23 in C. immitis pathogenesis, it presents several opportunities for therapeutic development:

• Target Validation: If TVP23 is essential for viability or virulence, it becomes a candidate for targeted inhibition. Researchers should perform careful phenotypic characterization of conditional TVP23 mutants to assess essentiality.

• Structural Studies: Determining the three-dimensional structure of TVP23 would facilitate structure-based drug design. Techniques like X-ray crystallography or cryo-EM, though challenging for membrane proteins, could provide crucial insights.

• Functional Assays for Screening: Development of high-throughput assays that measure TVP23 function would enable screening of compound libraries for potential inhibitors.

• Specificity Analysis: Comparative structural analysis between fungal TVP23 and human homologs would identify fungal-specific features that could be selectively targeted to minimize host toxicity.

• Combination Approaches: Researchers should explore potential synergistic effects between TVP23 inhibitors and existing antifungals that target different cellular processes.

How does C. immitis TVP23 compare to the human homolog TVP23B in terms of structure and function?

While detailed structural comparisons are not provided in the search results, functional studies of human TVP23B offer insights into potential conserved roles. Human TVP23B is a transmembrane protein that:

• Localizes to the trans-Golgi network

• Binds to YIPF6, another Golgi protein

• Regulates glycosylation enzyme distribution

• Controls mucin production and antimicrobial peptide secretion

Researchers comparing C. immitis TVP23 to human TVP23B should perform:

• Sequence alignment and structural prediction to identify conserved domains and transmembrane regions

• Heterologous expression studies to determine if fungal TVP23 can complement human TVP23B deficiency in appropriate cell models

• Subcellular localization studies to confirm Golgi positioning in both systems

• Functional assays to assess conservation of specific activities like protein binding and trafficking regulation

Understanding the similarities and differences between fungal and human TVP23 proteins could highlight fungal-specific features for therapeutic targeting while predicting potential off-target effects.

What can we learn from TVP23 expression patterns during the C. immitis life cycle?

The search results indicate that Coccidioides undergoes massive transcriptional reprogramming during the transition from mycelia to spherules . While TVP23-specific expression data is not provided, this transition represents a critical area for investigation. Researchers should:

• Apply techniques like csRNA-seq, which captures actively initiated transcripts regardless of stability, to profile TVP23 expression across all life cycle stages

• Compare TVP23 expression patterns in environmental versus host-mimicking conditions to identify regulatory triggers

• Correlate TVP23 expression with other genes involved in Golgi function and secretory pathway regulation

• Analyze the TVP23 promoter for transcription factor binding sites associated with morphological transition

The following table represents a hypothetical experimental approach for analyzing TVP23 expression:

How does C. immitis TVP23 relate to virulence mechanisms in other fungal pathogens?

While the search results don't provide direct comparative data between C. immitis TVP23 and virulence factors in other fungi, they offer contextual insights. Researchers exploring these relationships should:

• Perform comparative genomic analyses across pathogenic fungi to identify TVP23 homologs and assess conservation

• Investigate whether TVP23 is regulated by WOPR family transcription factors, which are known virulence regulators in multiple fungal pathogens

• Compare the Golgi secretory pathway composition between C. immitis and other pathogenic fungi to identify common and divergent features

• Assess whether TVP23 function correlates with specific virulence mechanisms like immune evasion, stress tolerance, or host adaptation across fungal species

This comparative approach could reveal conserved pathogenic mechanisms and suggest broadly applicable antifungal strategies targeting Golgi function across multiple fungal pathogens.

What are the critical quality control measures for recombinant TVP23 protein preparations?

When working with recombinant C. immitis TVP23, researchers should implement the following quality control measures:

• Purity Assessment: SDS-PAGE analysis should confirm >90% purity

• Identity Confirmation: Western blotting with anti-His tag antibodies and/or mass spectrometry

• Functional Validation: Depending on the intended application, appropriate binding or activity assays

• Stability Testing: Monitoring protein integrity after storage at recommended conditions

• Endotoxin Testing: For applications involving immune cells or in vivo studies, endotoxin levels should be measured and minimized

• Batch Consistency: Comparative analysis between production batches to ensure reproducibility