Recombinant Coccidioides immitis NADH-cytochrome b5 reductase 1 (CBR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CBR1; CIMG_05279; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Coccidioides immitis (strain RS) (Valley fever fungus)
Target Names
CBR1
Target Protein Sequence
MSSWTSKENINGVYIPSALLIFGTTIIKKEWIAYATALAVVLSAWKLFSNKPRKVLNPTE FQNFVLKDKTIVSHNVCIYRFALPRPTDILGLPIGQHISLAATIPGQSKEIVRSYTPISS DDDAGYFDLLVKSYPQGNISKHLTTLRIGDKMKVRGPKGAMVYTPNMVRHIGMIAGGTGI TPMLQVIKAIIKGRPRNGGNDTTQIDLIFANVNPDDILLKEELDQLAKEDDAFRIYYVLN NPPEKWNGGVGFVTPDMIKAKLPAPAGDIKVLICGPPPMVSAMKKATESLGYKKANLVSK LEDQVFCF
Uniprot No.

Target Background

Function
Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system is essential for the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How can recombinant CBR1 be used in developing diagnostic tools for coccidioidomycosis?

    Recombinant CBR1 has potential applications in developing improved diagnostic assays for coccidioidomycosis:

    1. Serological assays: Purified recombinant CBR1 can serve as an antigen in ELISA or immunoblot assays to detect anti-CBR1 antibodies in patient sera. While not as immunodominant as some other C. immitis antigens, CBR1 shows potential as part of a multi-antigen panel.

    2. PCR-based diagnostics: The CBR1 gene contains species-specific regions that can be targeted in molecular diagnostic assays. A duplex real-time PCR assay targeting the CBR1 gene region can differentiate between C. immitis and C. posadasii with high sensitivity (detection limit of ~10 genome copies) and specificity .

    3. Protein-based lateral flow assays: Recombinant CBR1, when coupled with specific antibodies, can be incorporated into rapid point-of-care tests.

    Research challenges include:

    • Potential cross-reactivity with homologous proteins from other fungi

    • Variability in antibody responses among patients

    • Need for species-specific epitopes when differentiating C. immitis from C. posadasii

    Recent studies have shown that combining CBR1-based detection with other biomarkers (such as proline-rich antigens) can significantly improve diagnostic sensitivity and specificity .

  • What role does CBR1 play in the oxidative stress response of Coccidioides immitis?

    CBR1 contributes significantly to oxidative stress defense mechanisms in C. immitis through several pathways:

    1. Direct ROS detoxification: As an NADH-dependent reductase, CBR1 can reduce certain oxidized compounds, particularly quinones, preventing them from generating reactive oxygen species (ROS).

    2. Maintenance of cellular redox homeostasis: By facilitating electron transfer in various metabolic pathways, CBR1 helps maintain proper NADH/NAD⁺ balance.

    3. Support of antioxidant systems: CBR1 provides reducing equivalents needed for recycling of other antioxidant systems.

    4. Membrane lipid protection: Through its role in fatty acid metabolism, CBR1 helps maintain membrane integrity during oxidative stress.

    Evidence from studies with other fungal pathogens suggests that CBR1 expression increases under oxidative stress conditions, similar to what has been observed with CBR1 in human breast cancer cells, where inhibition of CBR1 leads to increased ROS generation . This indicates that targeting CBR1 could potentially increase susceptibility of C. immitis to oxidative killing by host immune cells, making it a potential antifungal target .

  • How can site-directed mutagenesis of CBR1 help understand its catalytic mechanism?

    Site-directed mutagenesis is a powerful approach to elucidate structure-function relationships in CBR1:

    Target ResidueFunctionEffect of Mutation
    FAD-binding domain residuesCofactor bindingReduced FAD incorporation, lower stability
    NADH-binding pocket residuesSubstrate bindingAltered Km for NADH, substrate specificity changes
    Catalytic residuesElectron transferReduced catalytic rate, altered reaction mechanism
    Membrane-binding domainCellular localizationChanges in subcellular distribution

    Key residues worthy of investigation include:

    • Conserved glycine-rich motifs in the FAD-binding domain

    • Charged residues in the NADH-binding pocket

    • Tyrosine and histidine residues potentially involved in proton transfer

    Experimental approaches should include:

    1. Expression of mutant proteins in E. coli

    2. Comprehensive enzyme kinetics with various substrates

    3. Thermal stability analysis using differential scanning fluorimetry

    4. Spectroscopic characterization of FAD binding

    Such studies would provide valuable insights into the catalytic mechanism and could inform the design of specific inhibitors targeting C. immitis CBR1 while minimizing cross-reactivity with human homologs .

  • What implications does CBR1 function have for the development of novel antifungal therapeutics?

    CBR1 represents a promising antifungal target for several reasons:

    1. Essential function: Studies in other fungi, such as Arabidopsis, have shown that CBR1 is essential for pollen function and seed maturation, suggesting critical roles in fungal reproduction and development .

    2. Divergence from human homologs: Despite functional similarities, fungal CBR1 shows structural differences from human counterparts, potentially allowing selective targeting.

    3. Role in stress response: CBR1's involvement in oxidative stress resistance suggests that inhibitors could sensitize C. immitis to host immune defenses.

    Target validation studies should include:

    • Gene knockout or knockdown experiments in C. immitis

    • In vitro screening of small molecule inhibitors

    • Structural analysis of CBR1-inhibitor complexes

    Development considerations:

    • Design of competitive inhibitors targeting the NADH-binding site

    • Allosteric inhibitors affecting protein-protein interactions

    • Compounds disrupting membrane association

    Preliminary studies with other enzyme inhibitors suggest that targeting fungal reductases can enhance susceptibility to existing antifungals, potentially allowing combination therapies with reduced dosages of current drugs that have significant side effects .

  • How does CBR1 expression and activity change during different phases of Coccidioides life cycle?

    Coccidioides has a complex life cycle involving transformation between saprophytic (mycelial) and parasitic (spherule) phases. CBR1 expression and activity vary significantly across these phases:

    Life Cycle PhaseCBR1 Expression LevelFunctional Significance
    Hyphae (environmental)ModerateSupports fatty acid metabolism, normal growth
    Arthroconidia (infectious)Low-ModerateMetabolic quiescence, stress resistance
    Early spherule (host phase)UpregulatedAdaptation to host environment, stress response
    Mature spheruleHighly upregulatedSupport for rapid membrane synthesis, antioxidant defense
    Endospore formationHighly upregulatedMembrane biogenesis, cell division

    These changes reflect the metabolic shifts and stress conditions encountered during host invasion and colonization. Understanding these expression patterns requires:

    1. Transcriptomic analysis of different life cycle stages

    2. Protein expression studies using stage-specific cultures

    3. In situ activity assays in infected tissues

    Targeting CBR1 during the spherule phase might be particularly effective, as this is when the fungus is adapting to the host environment and potentially more vulnerable to metabolic disruption .

  • What approaches can be used to develop CBR1-targeted inhibitors with minimal cross-reactivity to human homologs?

    Developing selective inhibitors requires exploiting structural and functional differences between fungal and human CBR1:

    1. Structure-based design approaches:

      • X-ray crystallography or homology modeling of C. immitis CBR1

      • Comparative analysis with human CBR1 structures

      • Identification of unique binding pockets or conformational states

    2. High-throughput screening strategies:

      • Parallel screening against fungal and human enzymes

      • Selection of compounds with selectivity ratios >100-fold

      • Fragment-based approaches to build specificity

    3. Targeting unique features:

      • Fungal-specific membrane-binding domains

      • Differences in the FAD-binding pocket

      • Unique substrate access channels

    Preliminary success has been achieved with related enzymes using quinone-based competitive inhibitors and triazole derivatives that show selective binding to fungal reductases over human homologs. These compounds exploit subtle differences in the active site architecture that affect inhibitor binding orientation and affinity .

    The recent development of inhibitors targeting carbonyl reductase 1 in human cancer research provides valuable insights for the design of CBR1 inhibitors with improved selectivity profiles, potentially allowing for repurposing or modification of existing scaffold structures .

Research Application Questions

  • How can recombinant CBR1 be used to study cross-protection in vaccine development against coccidioidomycosis?

    Recombinant CBR1 can serve as a valuable tool in coccidioidomycosis vaccine research:

    1. Antigen characterization: Purified CBR1 can be used to assess immunogenicity and cross-reactivity between C. immitis and C. posadasii strains.

    2. Epitope mapping: Identifying conserved, immunogenic epitopes within CBR1 that could contribute to cross-protection.

    3. Adjuvant formulation testing: Testing different adjuvant combinations with recombinant CBR1 to enhance immune responses.

    4. Animal model studies: Using recombinant CBR1 alone or as part of multi-antigen formulations in mouse models to assess protective efficacy.

    Recent research has demonstrated that recombinant antigens derived from C. posadasii, such as rCpa1, can provide cross-protection against both Coccidioides species. Similar approaches could be applied to CBR1-based antigens .

    Key experimental findings show:

    • Recombinant antigens can induce significant reduction in fungal burden

    • Protection correlates with increased numbers of IFN-γ and IL-17-producing CD4+ T cells

    • Both C57BL/6 and human HLA-DR4 transgenic mice models show response

    These approaches could help develop a broadly protective vaccine against both Coccidioides species, addressing an urgent public health need in endemic regions .

  • What methodologies can be used to study the interaction between C. immitis CBR1 and host immune cells?

    Several complementary approaches can be employed:

    1. In vitro interaction studies:

      • Co-culture of recombinant CBR1 with human neutrophils, macrophages, and dendritic cells

      • Assessment of cytokine profiles, ROS production, and phagocytic activity

      • Flow cytometry to evaluate immune cell activation markers

    2. T-cell response evaluation:

      • ELISPOT assays to measure T-cell responses to CBR1 epitopes

      • Proliferation assays with patient-derived PBMCs

      • Cytokine profiling of T-cell responses (Th1/Th2/Th17)

    3. In vivo approaches:

      • Tracking CBR1-specific immune responses in mouse models

      • Adoptive transfer experiments with CBR1-primed T cells

      • Evaluation of vaccine-induced protection against challenge

    4. Imaging studies:

      • Fluorescently labeled CBR1 to track cellular uptake and processing

      • Intravital microscopy to visualize interactions in live tissues

    Recent studies demonstrate that effective protection against Coccidioides infection correlates with robust Th1 and Th17 responses. These methodologies can help determine if CBR1 can stimulate these protective immune responses and assess its potential as a vaccine component .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.