Recombinant Coccidioides immitis NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH-cytochrome b5 reductase 2 (MCR1) is an enzyme associated with the fungus Coccidioides immitis, which causes coccidioidomycosis, also known as Valley Fever . While the provided search results do not offer a detailed characterization of the "Recombinant Coccidioides immitis NADH-cytochrome b5 reductase 2 (MCR1)", the available data allows for an overview of the areas of study and related compounds.

Coccidioides immitis and Coccidioidomycosis

Coccidioides immitis is a pathogenic fungus endemic to arid and semi-arid regions, particularly in the southwestern United States . Infection occurs through the inhalation of airborne arthroconidia, leading to a spectrum of clinical manifestations, ranging from asymptomatic infection to severe, disseminated disease .

Research on Coccidioides

Research on Coccidioides focuses on understanding its biology, virulence factors, and the host immune response to develop effective diagnostics, treatments, and preventive measures . Some research areas include:

  • Vaccine Development: Studies have explored the development of vaccines against coccidioidomycosis. For example, a live vaccine using a Δcps1 strain has shown promising results in dogs, providing a high level of protection and driving the vaccine towards commercial veterinary use and continued development for human use .

  • Volatile Organic Compounds (VOCs): Research has investigated the VOC profiles of C. immitis and C. posadasii to differentiate between species and identify potential biomarkers for infection .

  • Genetic Transformation: Genetic transformation techniques using Agrobacterium tumefaciens have been employed to study gene function in C. immitis .

  • Drug Discovery: Studies focus on identifying and characterizing novel antifungal compounds that inhibit the growth of Coccidioides and other phytopathogenic fungi .

Related Research Areas

While specific information on Recombinant Coccidioides immitis NADH-cytochrome b5 reductase 2 (MCR1) is not available in the provided sources, research on similar proteins and enzymes provides context:

  • mcr-1 Gene: The mcr-1 gene, found in Escherichia coli ST95, mediates resistance to colistin, a last-line antibiotic. This gene encodes a phosphoethanolamine transferase that modifies lipid A, a component of lipopolysaccharide (LPS) .

  • Ccr1 in Streptomyces: Ccr1, a nucleoid-associated protein in Streptomyces, affects secondary metabolite production. It is transcriptionally activated during bacterial interactions and contains helix-turn-helix (HTH) and helicase C-terminal domains .

  • Cytochrome P450: Cytochrome P450 enzymes, which are mentioned in one of the abstracts, are studied for their role in fungal metabolism and as targets for antifungal compounds .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MCR1; CIMG_04932; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Coccidioides immitis (strain RS) (Valley fever fungus)
Target Names
MCR1
Target Protein Sequence
MFARFTFRTCRPAGQAIRKYASEASPKPSSNVPLYGGLALAAGGAYYYWQRQQSPQALEA ALKERSKVFIGGDQGWVDLKLAGIETLSHNVKRFRFEFPDSESVSGLHIASALLTKYKGP KDEKPTIRPYTPVSEEEQPGYLDLVVKQYPNGPMSTHLHNMAVGQQLSFKGPIPKYPWEQ NKHDHICMIAGGTGITPMYQIIRKIFNNPNDKTKVTLVFGNITEEDILLKKELDILENTY PRRFRAFYLLDKPPAGWTQGTGYVTKELLKTVLPEPKTENIKIFVCGPPGMYKAVSGPKN SPKDQGELTGLLKELGYDKDQVYKF
Uniprot No.

Target Background

Function

May mediate the reduction of outer membrane cytochrome b5.

Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.