Recombinant Coccidioides immitis Plasma membrane fusion protein PRM1 (PRM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
PRM1; CIMG_01497; Plasma membrane fusion protein PRM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-746
Protein Length
full length protein
Species
Coccidioides immitis (strain RS) (Valley fever fungus)
Target Names
PRM1
Target Protein Sequence
MQFSRFIPRSSPGLPPYGAHDPPMMQNPAPTTAPPGAITPYLGFKARLSQIWINKWTILL LLVLARVLIAVTGLNDNMASAKREALSACTSVESMGSAMASMPHYMSKGVNELTASGVER AVNGLMSMLLLTVTGVEEVVVFFVNVLTQTYLCLITLAVSGSLHVALKVVEDAADFLNKT LADVTEGIEKGVDGFEDKINDFLKGINSITSAFGGEKDPPKLDIGGDLDKLKEIRLPSSL DEGLKKINDSIPTFDEVNKFANDAIRYPFKEVKKLINQSLEEYKFDRSVFPVPQKEKLSF CGDNDGINSFFGKIGSIISTAKKIFIAVLIAGAVAACVPMALLEIRRWRHMKERASLVQK NDHDPMDVVYIVSRPYTSTAGLKIASWFKPGRRQVLVRWIVAYATTTPALFLLALGIAGL FSCACQAILLHAVKKEVPGLTNEVSQFADKVVMSLNNASEQWAISTNRVIADTNDDINQK VFGWVNTSTTSINDTLNVFVDKTSDVLNDTFGGTILHGPIKDVLYCLIGLKIQGIQKALT WVYDHAHVDFPNMPNDTFSLGAVESIANDNKSDPESFLASPGDKTADAITHVVVRVTEAI ENAIRTEALISTFLIALWFAILLIAVLRALTLAFRRDKPRGEGGIDATYHPPAPRAAHAV GSMEMSDFYNVPLTGVPNANGDGGLAPKYSTTPHVRGGSRGSDTDEEEYQAQKLGYAGQR DYEAALNREMCRESSCGQVMYGSEKR
Uniprot No.

Target Background

Function
PRM1 plays a crucial role in cell fusion during mating by stabilizing the plasma membrane fusion event.
Database Links
Protein Families
PRM1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of PRM1 in Coccidioides immitis?

PRM1 (Plasma membrane fusion protein 1) in C. immitis likely functions similarly to its homologs in other fungi as a multispanning transmembrane protein that localizes to sites of cell-cell contact where membrane fusion occurs. Research in related fungi shows that PRM1 is selectively expressed during mating processes and is critical for plasma membrane fusion . When studying C. immitis PRM1, researchers should consider that deletion mutants (Δprm1) in other fungal models show a characteristic phenotype where cells initiate contact but fail to complete membrane fusion, resulting in tightly apposed membranes separated by a uniform gap of approximately 8 nm . Methodologically, this can be investigated using electron microscopy of mating pairs in knockout studies.

How is PRM1 structurally characterized in Coccidioides species?

While specific structural data for C. immitis PRM1 is limited in the provided search results, research approaches should consider that PRM1 is a multispanning transmembrane protein. When investigating its structure, researchers should employ techniques such as hydropathy analysis to predict transmembrane domains, followed by experimental validation using epitope tagging at various positions. For visualization, researchers can create PRM1-GFP fusion proteins, as has been done in other fungi, where imaging required specialized techniques such as deconvolution of high-intensity laser scans to document the protein's localization at cell-cell contact sites .

What techniques are most effective for studying PRM1 expression patterns during different stages of the Coccidioides life cycle?

Researchers should implement a multi-faceted approach including:

  • Quantitative RT-PCR to measure mRNA levels during different developmental stages

  • Western blot analysis using anti-PRM1 antibodies to detect protein expression

  • Fluorescent reporter systems such as PRM1-GFP fusions for in vivo localization studies

For imaging weakly expressed proteins like PRM1, specialized microscopy techniques may be required. As demonstrated in other fungal studies, a combination of high-intensity laser scanning followed by deconvolution of optical sections can be effective . When designing experiments, researchers should account for the fact that PRM1 expression is likely to be highly regulated and may only be detectable during specific developmental stages, particularly those involving cell-cell interactions.

What are the optimal conditions for recombinant expression of C. immitis PRM1 protein?

For recombinant expression of C. immitis PRM1, researchers should consider:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, cost-effectiveMay not properly fold multi-spanning membrane proteinsRequires fusion tags and solubilization strategies
Yeast (S. cerevisiae)Better for eukaryotic protein foldingLower yield than bacterial systemsCan complement yeast Δprm1 mutants to test functionality
Insect cellsSuperior for complex eukaryotic proteinsMore expensive, technically demandingBaculovirus expression system recommended
Filamentous fungiMost native-like post-translational modificationsTechnically challengingConsider heterologous expression in Aspergillus spp.

When expressing recombinant PRM1, researchers should incorporate epitope or fluorescent tags that don't interfere with membrane insertion or protein function. For purification, detergent screening is essential to identify conditions that maintain protein stability and native conformation. Functional validation of the recombinant protein can be performed using complementation assays in Δprm1 mutant fungi to confirm restoration of membrane fusion capacity.

What genetic manipulation techniques are most successful for studying PRM1 function in Coccidioides species?

Given the biosafety considerations when working with Coccidioides (BSL-3 pathogen), researchers should consider:

  • CRISPR-Cas9 gene editing techniques adapted for filamentous fungi

  • Conditional expression systems (e.g., tetracycline-inducible) to control PRM1 expression

  • Homologous recombination-based gene replacement for creating knockout mutants

When designing knockout experiments, researchers must consider that complete deletion of PRM1 in some fungi results in mating defects but not necessarily growth defects in vegetative cells . Therefore, phenotypic analysis should focus specifically on developmental stages involving cell-cell fusion. For safety and technical feasibility, initial studies might be conducted in model organisms with PRM1 homologs before advancing to Coccidioides species.

How does PRM1 contribute to Coccidioides immitis virulence or pathogenicity?

While direct evidence linking PRM1 to C. immitis virulence is not extensively documented in the provided search results, researchers should investigate:

  • Whether PRM1 is involved in morphological transitions that are critical for pathogenicity

  • If PRM1-mediated membrane fusion events play a role in host cell interactions

  • The expression profile of PRM1 during infection using animal models

Research approaches should include creating PRM1 knockout strains and evaluating their virulence in appropriate animal models, similar to methodologies used for other C. immitis virulence factors. Comparative virulence studies between wild-type and Δprm1 mutants could reveal whether membrane fusion events mediated by PRM1 contribute to pathogenesis. Researchers should also investigate whether anti-PRM1 antibodies have any protective effect in infection models.

Could PRM1 be a potential target for vaccine development against coccidioidomycosis?

When evaluating PRM1 as a vaccine candidate, researchers should consider the approach used for the recombinant multivalent vaccine (rCpa1) that demonstrated cross-protection against both Coccidioides species . The methodological framework would include:

  • Determining sequence conservation of PRM1 across clinical isolates of both C. immitis and C. posadasii

  • Identifying immunogenic epitopes within PRM1 that could stimulate protective T-cell responses

  • Evaluating whether recombinant PRM1 or peptide fragments can induce specific IFN-γ and IL-17-producing CD4+ T cells, which are associated with protection

Research has shown that effective vaccines against Coccidioides require activation of both Th1 and Th17 immune responses . To determine PRM1's vaccine potential, researchers should evaluate recombinant PRM1 formulations in both C57BL/6 and human HLA-DR4 transgenic mice, measuring fungal burden reduction and T-cell activation post-challenge with virulent Coccidioides isolates.

How does C. immitis PRM1 compare functionally to PRM1 proteins in other fungal species?

Researchers investigating functional conservation of PRM1 should conduct comparative analyses between C. immitis PRM1 and homologs in other fungi, particularly model organisms where PRM1 has been well-characterized. In Saccharomyces cerevisiae, PRM1 has been definitively shown to function in plasma membrane fusion during mating . Methodologically, researchers can:

  • Perform complementation studies by expressing C. immitis PRM1 in S. cerevisiae Δprm1 mutants to test functional conservation

  • Compare localization patterns using fluorescently tagged proteins

  • Identify conserved functional domains through mutagenesis studies

When analyzing complementation results, researchers should look for restoration of membrane fusion capacity in heterologous systems, recognizing that partial complementation may occur due to species-specific interaction partners.

What structural or functional similarities exist between fungal PRM1 and human genes associated with membrane fusion?

While fungal PRM1 and human genes may have distinct evolutionary origins, researchers should investigate potential functional parallels in membrane fusion mechanisms. Methodologically, this requires:

  • Bioinformatic analysis to identify human proteins with similar predicted membrane topology

  • Comparative analysis of conserved domains involved in membrane fusion

  • Investigation of whether human membrane fusion proteins can complement fungal Δprm1 mutants

Interestingly, mutations in human genes with different names but similar functions can lead to specific phenotypes. For example, mutations in human PRM1 (Protamine 1, not directly related to fungal PRM1) are associated with male infertility . Researchers should investigate whether membrane fusion proteins in human reproduction share any mechanistic similarities with fungal PRM1, despite different evolutionary origins.

How can high-resolution imaging techniques be optimized for studying PRM1-mediated membrane fusion events?

Advanced imaging of PRM1-mediated fusion requires specialized approaches:

  • Live-cell super-resolution microscopy (e.g., STORM, PALM) to visualize PRM1 dynamics during fusion

  • Correlative light and electron microscopy (CLEM) to connect PRM1 localization with ultrastructural changes

  • Fluorescence resonance energy transfer (FRET) to detect PRM1 interactions with other fusion proteins

Researchers should adapt the imaging protocol described for yeast PRM1-GFP, which involved first taking a single medial optical section by averaging four high-intensity laser scans, followed by collecting a stack of eight optical sections to document remaining fluorescence . For C. immitis, additional optimization will be required due to different cell morphology and potentially lower expression levels. Time-lapse imaging should be employed to capture the dynamic process of membrane juxtaposition and fusion or arrest.

What recombination strategies might affect PRM1 gene evolution in Coccidioides species?

When studying PRM1 gene evolution in Coccidioides, researchers should consider recombination as a driver of sequence evolution, similar to patterns observed in other genomic regions . Methodological approaches should include:

  • Analysis of linkage disequilibrium patterns across PRM1 to identify potential recombination hotspots

  • Comparative genomics of PRM1 regions in diverse C. immitis and C. posadasii isolates to detect signatures of recombination

  • Investigation of whether PRDM9 binding sites exist near PRM1, as PRDM9 has been shown to localize recombination peaks in humans

It's worth noting that recombination rates can differ significantly between populations , so researchers should include isolates from various geographic regions when studying PRM1 evolution. The extensive genome hybridization observed among clinical isolates of C. posadasii and C. immitis may influence PRM1 sequence variation and should be considered in evolutionary analyses.

What experimental approaches can distinguish between the direct and indirect effects of PRM1 deletion on membrane fusion phenotypes?

To rigorously distinguish direct from indirect effects of PRM1 deletion, researchers should implement:

  • Structure-function analysis using site-directed mutagenesis of specific PRM1 domains

  • Rapid inducible/repressible systems to observe immediate versus long-term effects of PRM1 depletion

  • Rescue experiments with chimeric proteins containing different domains from PRM1 homologs

Electron microscopy analysis of Δprm1 mutants has revealed a specific phenotype where membranes remain separated by a uniform gap of ~8 nm , suggesting direct involvement in the fusion process. To further validate direct effects, researchers should develop in vitro reconstitution assays with purified recombinant PRM1 protein incorporated into liposomes to test whether it is sufficient to promote membrane fusion or if additional factors are required.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.