Recombinant Coccidioides immitis Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Description

Introduction to Get1/2 Complex

The Get1/2 complex is known for its role in the insertion of tail-anchored (TA) proteins into the endoplasmic reticulum (ER) membrane in yeast. This complex is crucial for the proper targeting and integration of TA proteins, which are essential for various cellular functions .

Coccidioides immitis Overview

Coccidioides immitis is a pathogenic fungus causing coccidioidomycosis, commonly known as Valley Fever. It is prevalent in the southwestern United States and parts of Central and South America. Research on C. immitis focuses on understanding its pathogenesis, virulence factors, and genetic diversity .

Potential for Recombinant Proteins in Research

Recombinant proteins are widely used in research for studying protein functions, vaccine development, and diagnostic tools. If a recombinant protein similar to GET1 were to be developed for C. immitis, it could potentially aid in understanding specific biological processes or serve as a tool for studying fungal pathogenesis.

Data Tables

Since there is no specific data available for "Recombinant Coccidioides immitis Protein GET1 (GET1)", the following table provides a general overview of related research areas:

Research AreaDescriptionRelevance
Get1/2 ComplexER membrane protein complex for TA protein insertion in yeast.Provides insights into protein targeting mechanisms.
Coccidioides immitisPathogenic fungus causing Valley Fever.Focuses on pathogenesis and virulence factors.
Recombinant ProteinsTools for studying protein functions and vaccine development.Could be applied to C. immitis research if relevant proteins are identified.

References

  1. Get1/2 Complex:

  2. Coccidioides immitis:

  3. Recombinant Proteins: General knowledge; no specific references available for "Recombinant Coccidioides immitis Protein GET1 (GET1)".

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. Please specify your required tag type for preferential development.
Synonyms
GET1; CIMG_04193; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Coccidioides immitis (strain RS) (Valley fever fungus)
Target Names
GET1
Target Protein Sequence
MPSLLIIVLIIHVVTYLINTIGANTIDSLLWLLYLKLPNQTSQTANEQRRLKREVMQLKR EMNATSSQDEFAKWAKLRRRHDKTMEEYEAKNKALGKHKSSFDLAVKSIRFFSTTGLKLF LQFWCSKTPIFELPRGWIPWQVEWVLSFPRAPLGTVSIQIWGGVCATVVSLAGDAIGVVN VYLTSKAPKQKEPATSGENSARPMAIKKEL
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Coccidioidomycosis and which species cause this disease?

Coccidioidomycosis (Valley fever) is caused by two closely related fungal species: Coccidioides posadasii (Cp) and Coccidioides immitis (Ci). These species share approximately 95-96% genomic sequence identity, with approximately 4-5% difference in their genomic sequences. Both species are pathogenic fungi that can cause pulmonary infections in humans and other mammals. The disease is endemic to specific regions of the Americas, particularly the southwestern United States and parts of Mexico and South America .

What are the major antigenic proteins identified in Coccidioides immitis?

Several major antigenic proteins have been identified in C. immitis, including a 19-kDa Coccidioides-specific antigen (CS-Ag) with serine proteinase activity that is heat-stable and appears to be specific for this pathogenic fungus . Additionally, a 48-kDa T-cell-reactive protein (TCRP) has been identified that stimulates proliferative responses and production of gamma interferon by T cells of mice immunized with C. immitis spherules . Research has also focused on developing recombinant chimeric polypeptide antigens (such as rCpa1) that combine multiple immunogenic fragments from various Coccidioides proteins .

What is the GET pathway and how might it relate to fungal biology?

The GET (Guided Entry of Tail-anchored protein) pathway is a conserved mechanism for tail-anchored membrane protein (TA) biogenesis in eukaryotic cells. This pathway involves the Get3 ATPase, which delivers tail-anchored membrane proteins to the Get1/2 receptor complex at the endoplasmic reticulum. The cytosolic domains of Get1 and Get2 cooperate to capture the Get3-TA complex and facilitate insertion of the tail-anchored proteins into the membrane . Since this pathway is conserved across eukaryotes, it likely plays important roles in fungal cells including C. immitis, though specific research on GET pathway proteins in Coccidioides species is limited in the provided search results.

How do recombinant Coccidioides proteins induce protective immunity against both C. posadasii and C. immitis?

Recombinant Coccidioides proteins, particularly chimeric constructs like rCpa1, induce protection through activation of early Th1 and Th17 immune responses. In mouse models, vaccination with rCpa1 results in significant reduction of fungal burden and increased numbers of IFN-γ- and IL-17-producing CD4+ T cells in the first two weeks post-challenge. The cross-protection between species occurs despite amino acid substitutions in the rCpa1 antigen between C. posadasii and C. immitis (seven identified substitutions). This cross-protection is possible because the vaccine targets conserved antigenic regions that stimulate long-lasting, antigen-specific adaptive immune responses in both C57BL/6 and human HLA-DR4 transgenic mice .

What molecular mechanisms underlie the cooperation between Get1 and Get2 cytosolic domains in the GET pathway?

The cytosolic domains (CDs) of Get1 and Get2 demonstrate significant cooperative behavior that enhances the function of the Get1/2 receptor. Complex assembly between Get1CD and Get2CD strongly enhances the affinity of the individual subunits for the Get3- TA complex, enabling efficient capture of the targeting complex. Get1CD plays a known role in remodeling Get3 conformation, while two molecular recognition features (MoRFs) in Get2CD induce Get3 opening. Both subunits are required for optimal release of tail-anchored proteins from Get3. Mutation studies of the MoRFs show attenuated TA insertion into the endoplasmic reticulum in vivo, highlighting the importance of these features in membrane protein biogenesis .

What are the genomic and structural characteristics of Coccidioides-specific antigens?

The Coccidioides-specific antigen (CS-Ag) gene (csa) has been fully sequenced and characterized. It contains a 543-bp open reading frame that encodes a 181-amino-acid protein with a predicted molecular mass of 19.8 kDa and an isoelectric point of 8.3. Notably, the csa gene has no introns and has been localized to chromosome I of C. immitis clinical isolates. The native CS-Ag is secreted via cleavage of a putative 23-residue signal peptide and shows low levels of glycosylation, containing xylose, mannose, galactose, and glucose, though it shows no affinity for concanavalin A .

What adjuvant systems are most effective for recombinant Coccidioides protein vaccines?

For recombinant Coccidioides protein vaccines, glucan-chitin particles (GCP) have proven to be effective adjuvants. The GCP-rCpa1 vaccine formulation significantly decreases pulmonary fungal burden by eliciting both Th1 and Th17 responses without inducing nonprotective Th2-type responses. The recognition of GCP in murine models is attributed to C-type lectin members Dectin-1 and Dectin-2 via CARD9 signaling. When designing experiments with GCP adjuvants, researchers should allow at least 3-4 weeks of resting period between immunization and challenge to prevent nonspecific T-helper responses sometimes observed with the GCP adjuvant .

How should researchers design PCR-based detection methods for Coccidioides species?

PCR-based detection methods for Coccidioides can be designed using species-specific genes as targets. For example, a highly sensitive and specific PCR method has been developed based on the csa gene sequence. Using synthetic oligonucleotide primers derived from the csa gene sequence, a 520-bp product can be amplified specifically from C. immitis genomic DNA. This method has demonstrated high sensitivity, with detection limits of 1 pg of C. immitis genomic DNA by ethidium bromide staining and 100 fg after Southern hybridization. When designing such assays, researchers should validate specificity against other fungal species and optimize PCR conditions to ensure reliable detection in both laboratory and clinical specimens .

What experimental approaches are most effective for studying protein-protein interactions in the GET pathway?

Effective approaches for studying protein-protein interactions in the GET pathway include a combination of biochemical and structural methods. Researchers can use recombinant protein expression systems to produce the cytosolic domains of GET pathway components, followed by in vitro binding assays to measure interaction affinities and kinetics. Additionally, structural studies using X-ray crystallography or cryo-electron microscopy can reveal the conformational changes that occur during complex formation. Functional assays measuring TA protein insertion into reconstituted membrane systems provide insights into the biological relevance of observed interactions. In vivo validation through mutagenesis of key interaction sites (such as the MoRFs in Get2CD) helps connect biochemical observations to biological functions .

How should researchers interpret T-cell response data in Coccidioides vaccine studies?

When interpreting T-cell response data in Coccidioides vaccine studies, researchers should focus on several key metrics. First, compare the expansion of specific T-cell subsets (Th1, Th17, and Th2) between vaccinated and control groups, as measured by flow cytometry and cytokine production assays. Protective efficacy against coccidioidomycosis is associated with early responses via T helper cell expansion, particularly Th1 and Th17 cells. Researchers should examine IFN-γ and IL-17 production by CD4+ T cells at early time points post-challenge (7-14 days) as these are strong correlates of protection. It's also important to monitor whether the vaccine induces Th2 responses (IL-4, IL-5), as these are generally associated with reduced protection. Different mouse strains may show varying T-cell response profiles; for example, genetically resistant DBA/2 mice develop Th1-biased responses with early induction of IFN-γ, whereas susceptible BALB/c mice show early secretion of the Th2 cytokine IL-4 .

What statistical approaches are appropriate for analyzing cross-protection data in fungal vaccine studies?

When analyzing cross-protection data in fungal vaccine studies, researchers should employ statistical approaches that account for the multiple variables involved in vaccine efficacy. For comparing fungal burden between vaccinated and control groups challenged with different fungal isolates, ANOVA with appropriate post-hoc tests (such as Tukey's or Bonferroni) is recommended to account for multiple comparisons. Non-parametric alternatives (Kruskal-Wallis with Dunn's post-test) may be more appropriate for data that doesn't meet the assumptions of parametric tests. For survival data, Kaplan-Meier curves with log-rank tests should be used. When analyzing immune responses, multivariate statistical methods can help identify correlates of protection across different T-cell subsets and cytokine profiles. Researchers should always include appropriate controls, including mock-immunized groups (e.g., GCP-MSA) and unvaccinated groups, to distinguish specific vaccine effects from non-specific adjuvant effects .

How can researchers resolve contradictions in data regarding antigen localization in Coccidioides?

When faced with contradictions in antigen localization data, researchers should implement a multi-technique approach for validation. For instance, in studies of the 48-kDa TCRP, immunofluorescence showed the antigen was localized primarily in the cell wall of arthroconidia, while subsequent analysis indicated cytoplasmic localization in parasitic cells . To resolve such discrepancies, researchers should: (1) Use multiple complementary techniques (immunofluorescence, immunoelectron microscopy, subcellular fractionation followed by Western blotting); (2) Examine antigen localization across different morphological forms of the fungus (arthroconidia, spherules, endospores); (3) Validate antibody specificity with appropriate controls; (4) Consider that localization may change during different growth stages or under different environmental conditions; and (5) Use proteins with known localization patterns as controls in each experiment. Researchers should also consider that recombinant proteins may fold differently than native proteins, potentially affecting antibody recognition .

How can the knowledge of Coccidioides immunogenic proteins be translated into clinical diagnostics?

Translating knowledge of Coccidioides immunogenic proteins into clinical diagnostics involves several strategic approaches. PCR-based detection methods targeting specific genes like csa offer high sensitivity and specificity for identifying Coccidioides DNA in clinical specimens. With detection limits as low as 100 fg of genomic DNA after Southern hybridization, these methods are promising for early diagnosis. Serological assays can be developed using recombinant proteins like the 19-kDa CS-Ag or the 48-kDa TCRP, which have shown reactivity with sera from patients with confirmed coccidioidal infection. Notably, studies have found that high titers of antibody to recombinant TCRP correlate with elevated titers to the serodiagnostic complement fixation antigen of C. immitis, suggesting clinical utility. For implementation, researchers should validate these diagnostic approaches with diverse clinical specimens, establish appropriate sensitivity and specificity thresholds, and compare performance against conventional diagnostic methods .

What are the potential applications of understanding GET pathway proteins in antifungal drug development?

Understanding GET pathway proteins offers several potential applications for antifungal drug development. Since the GET pathway is conserved across eukaryotes but has distinct differences between fungi and humans, these differences could be exploited for selective targeting. Inhibiting the interaction between Get3 and the Get1/2 receptor could disrupt proper insertion of tail-anchored proteins, many of which are essential for cellular functions including vesicular trafficking, protein quality control, and membrane dynamics. Compounds that specifically target the molecular recognition features (MoRFs) in fungal Get2 could selectively impair fungal growth while minimizing effects on human cells. Additionally, since tail-anchored proteins are involved in stress responses, disrupting their biogenesis could potentially enhance the efficacy of existing antifungals by reducing fungal stress adaptation capabilities. Future research should focus on characterizing GET pathway components in pathogenic fungi including Coccidioides species to identify fungal-specific features that could serve as drug targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.