Recombinant Coccidioides posadasii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
RCF1; AIM31; CPC735_063380; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Coccidioides posadasii (strain C735) (Valley fever fungus)
Target Names
RCF1
Target Protein Sequence
MSDKPLPSSFDSDPEFFEENPWVKLRRRLREEPLIPLGCAATSYALWRAYKSMKAGDSDQ LNRMFRYRIYAQAFTLVAVVVGGIYYKSERAQRKELERAMEEKKSQAKRDAWLRELEIRD QEDRDWRERHAAVERAAKEAGMKPKDVSKGLAGESAGNQEGEAKSNVGVLDAVKNLVKEK
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AIM31 and what is its role in Coccidioides posadasii?

AIM31 (Altered inheritance of mitochondria protein 31) in Coccidioides posadasii is a mitochondrial protein also known by several synonyms including RCF1 (Respiratory supercomplex factor 1) and is encoded by the gene CPC735_063380 . This protein is classified as a "Hypoxia induced family protein," suggesting its involvement in the fungal response to low-oxygen conditions .

The protein appears to be involved in mitochondrial function, specifically in respiratory chain organization and potentially in the inheritance of mitochondria during cell division. Based on its homology to similar proteins in other fungi, AIM31 likely plays a role in maintaining mitochondrial integrity and function in C. posadasii, which may be particularly important during the pathogen's adaptation to the host environment during infection.

How does AIM31 relate to mitochondrial function and pathogenesis?

As a mitochondrial protein, AIM31 is likely involved in several critical cellular processes:

  • Respiratory chain function: As a homolog of Respiratory supercomplex factor 1 (RCF1), it may play a role in the assembly or stability of respiratory chain complexes .

  • Hypoxia response: Its classification as a "Hypoxia induced family protein" suggests upregulation during oxygen-limited conditions, which C. posadasii would encounter within host tissues during infection .

  • Mitochondrial inheritance: The "Altered inheritance of mitochondria" designation implies a role in ensuring proper distribution of mitochondria during cell division.

These functions may contribute to C. posadasii's ability to adapt to the changing environments encountered during infection and could represent potential targets for antifungal development.

How can genetic studies of AIM31 inform our understanding of C. posadasii pathogenesis?

Studying AIM31 in C. posadasii can provide several valuable insights into fungal pathogenesis:

  • Adaptation to hypoxic environments: Many infection sites are hypoxic, and understanding how AIM31 functions in these conditions may reveal how C. posadasii adapts to host environments.

  • Mitochondrial dynamics during infection: Examining AIM31's role in mitochondrial function during different stages of infection could reveal energy metabolism adaptations that occur as the fungus transitions between its environmental and parasitic forms.

  • Comparative genomics approach: The differentiation between C. posadasii and C. immitis was achieved through genetic analysis, including real-time PCR assays targeting specific genomic regions . Similar approaches could be used to study the AIM31 gene across Coccidioides strains to identify variations that correlate with virulence.

  • Gene expression patterns: Studies of C. posadasii gene expression, similar to those conducted for other genes like GEL1 (which showed highest expression during endosporulation) , could reveal when AIM31 is most active during the infection cycle.

What methodologies can be employed to study AIM31 function in mitochondrial processes?

Several experimental approaches can be used to investigate AIM31 function:

  • Gene deletion/knockdown studies: Creating AIM31-deficient strains to assess the impact on mitochondrial function, hypoxia response, and virulence.

  • Mitochondrial function assays: Measuring respiratory capacity, membrane potential, and ATP production in wild-type versus AIM31-mutant strains.

  • Protein-protein interaction studies: Immunoprecipitation or yeast two-hybrid assays to identify binding partners of AIM31, which could reveal its role in mitochondrial complexes.

  • ARCUS genome editing: Adaptation of mitochondrial-targeted genome editing technologies, similar to the mitoARCUS system described for targeting mitochondrial DNA mutations , could be used to specifically modify AIM31 in the mitochondrial genome to study its function.

  • Hypoxia response experiments: Culturing C. posadasii under varying oxygen tensions to assess AIM31 expression levels and mitochondrial adaptations.

How does C. posadasii AIM31 compare with homologs in other fungal species?

Comparative analysis of AIM31 across fungal species reveals important evolutionary and functional insights:

SpeciesGene NameProtein CharacteristicsNotable Differences
Coccidioides posadasiiCPC735_063380; AIM31180 aa, Hypoxia induced family proteinFocus of this FAQ
Pichia pastorisPAS_chr1-3_0297AIM31 homologPotentially different regulatory mechanisms
Penicillium marneffeiPMAA_094690Described as "mitochondrial hypoxia responsive domain protein"More explicit connection to hypoxia response
Laccaria bicolorLACBIDRAFT_293603Predicted protein with AIM31 homologyNon-pathogenic comparison
Coprinopsis cinereaCC1G_11439Hypothetical protein with AIM31 homologyNon-pathogenic comparison

These comparisons can help identify conserved domains essential for AIM31 function across fungi, as well as adaptations specific to pathogenic species like C. posadasii .

What are the optimal conditions for expression and purification of recombinant AIM31?

Based on the available information, the following protocol represents current best practices for recombinant AIM31 production:

  • Expression system: E. coli is the most commonly used system for AIM31 expression, though yeast, baculovirus, or mammalian cell systems are alternatives depending on research needs .

  • Vector design: Typically includes an N-terminal His-tag to facilitate purification and may include the full-length protein (amino acids 1-180) .

  • Purification: Immobilized metal affinity chromatography (IMAC) is standard for His-tagged proteins, followed by additional purification steps if needed.

  • Quality control: SDS-PAGE analysis should confirm >90% purity .

  • Storage conditions:

    • Lyophilized powder form

    • For reconstitution: deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles

How can researchers verify AIM31 functionality after recombinant production?

Verification of recombinant AIM31 functionality can be approached through multiple complementary techniques:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to analyze secondary structure

    • Limited proteolysis to confirm proper folding

    • Size exclusion chromatography to verify oligomeric state

  • Functional assays:

    • Membrane binding assays to confirm interaction with mitochondrial membranes

    • Respiration assays in reconstituted systems

    • Complementation assays in AIM31-deficient yeast or fungal systems

  • Interaction studies:

    • Pull-down assays with known mitochondrial complex components

    • Surface plasmon resonance to measure binding affinities

    • Crosslinking studies to identify proximal proteins in complexes

What approaches can be used to study potential roles of AIM31 in C. posadasii pathogenesis?

Several experimental approaches can link AIM31 function to fungal pathogenesis:

  • Gene expression analysis during infection:

    • Similar to approaches used for the GEL1 gene, where mRNA levels were monitored during the parasitic cycle

    • RT-PCR can be used to amplify AIM31 from infected tissues, alongside Coccidioides-specific markers to confirm infection

  • Virulence studies with AIM31 mutants:

    • Generate knockout, knockdown, or point-mutant strains

    • Assess virulence in animal models of coccidioidomycosis

    • Measure fungal burden in tissues, similar to methods used for vaccine efficacy studies

  • Immunological studies:

    • Determine if AIM31 is immunogenic during infection

    • Assess if antibodies against AIM31 correlate with disease severity or protection

    • Evaluate potential as a diagnostic marker for C. posadasii infection

  • Species differentiation:

    • Utilize PCR-based methods similar to those developed to distinguish C. immitis from C. posadasii

    • Examine if AIM31 sequence variations correlate with geographic distribution or virulence

How can genome editing technologies be applied to study AIM31 function in C. posadasii?

Recent advances in genome editing can be adapted to study AIM31:

  • CRISPR/Cas9 system adaptation:

    • Modify protocols for fungal systems to target the AIM31 gene

    • Create precise mutations to study structure-function relationships

    • Generate conditional knockouts using inducible promoters

  • Mitochondrial targeting approaches:

    • Adapt mitochondrial-targeted nucleases similar to mitoARCUS

    • Create heteroplasmy models to study AIM31 dosage effects

    • Study AIM31 role in maintaining mitochondrial genome integrity

  • Reporter systems:

    • Create fusion proteins with fluorescent tags to study localization

    • Use split reporter systems to study protein-protein interactions in live cells

    • Develop inducible expression systems to control AIM31 levels

  • Base editing technologies:

    • Introduce specific point mutations without double-strand breaks

    • Study the effect of natural variants on protein function

    • Create models of potential drug resistance mutations

What analytical methods are best suited for studying AIM31 protein-protein interactions?

To understand AIM31's role in mitochondrial complexes, several methods can identify interaction partners:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down tagged AIM31 and associated proteins

    • Mass spectrometry to identify binding partners

    • Western blotting to confirm specific interactions

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins to identify proximal proteins in living cells

    • Time-resolved labeling to detect dynamic interactions

    • Suborganellar mapping of interaction networks

  • Crosslinking mass spectrometry (XL-MS):

    • Chemical crosslinking to capture transient interactions

    • Identification of specific binding interfaces

    • Structural modeling of complexes

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for measuring interactions in solution

How might studying AIM31 contribute to developing novel antifungal approaches?

AIM31 research could lead to innovative therapeutic strategies:

  • Target validation:

    • Determine if AIM31 is essential for fungal viability or virulence

    • Assess if inhibition affects fungal survival in host conditions

    • Evaluate conservation across pathogenic fungi for broad-spectrum potential

  • Drug screening approaches:

    • Develop high-throughput assays for AIM31 function

    • Screen for small molecule inhibitors of AIM31

    • Structure-based drug design targeting AIM31-specific features

  • Combination therapy potential:

    • Assess synergy between AIM31 inhibitors and conventional antifungals

    • Target multiple mitochondrial functions simultaneously

    • Exploit host-pathogen metabolic differences

  • Immunotherapeutic potential:

    • Evaluate AIM31 as a vaccine candidate

    • Assess if antibodies against AIM31 have protective effects

    • Explore AIM31's potential as an immunodiagnostic marker for coccidioidomycosis

What are the major challenges in studying AIM31 function in C. posadasii?

Researchers face several significant challenges:

  • Biosafety considerations:

    • C. posadasii is a BSL-3 pathogen, limiting research accessibility

    • Need for specialized containment facilities

    • Challenges in obtaining clinical isolates

  • Technical limitations:

    • Difficulty in culturing the dimorphic phases of the fungus

    • Limited genetic tools compared to model fungi

    • Challenges in isolating pure mitochondria from pathogenic fungi

  • Functional redundancy:

    • Potential overlap with other mitochondrial proteins

    • Multiple pathways for mitochondrial inheritance and function

    • Compensatory mechanisms that may mask AIM31 phenotypes

  • Translation of findings:

    • Bridging in vitro results to in vivo significance

    • Species differences between animal models and human disease

    • Correlating molecular findings with clinical observations

How might AIM31 research inform broader understanding of fungal mitochondrial biology?

AIM31 research has implications beyond C. posadasii:

  • Evolutionary insights:

    • Understanding conservation of mitochondrial inheritance mechanisms across fungi

    • Identification of pathogen-specific adaptations

    • Tracing the co-evolution of nuclear and mitochondrial genomes

  • Fundamental mitochondrial biology:

    • Mechanisms of organelle inheritance and quality control

    • Respiratory chain assembly and maintenance

    • Mitochondrial responses to environmental stressors

  • Host-pathogen interactions:

    • Role of mitochondrial function in adaptation to host environments

    • Metabolic shifts during infection

    • Immune recognition of fungal mitochondrial components

  • Biotechnological applications:

    • Improved expression systems for mitochondrial proteins

    • Novel tools for mitochondrial genome manipulation

    • Bioproduction of specialized metabolites through mitochondrial engineering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.