Recombinant Coccidioides posadasii Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Coccidioides posadasii Probable Endonuclease LCL3 (LCL3)

Recombinant Coccidioides posadasii Probable endonuclease LCL3 (LCL3) is a protein derived from the fungus Coccidioides posadasii, a pathogen responsible for coccidioidomycosis, also known as San Joaquin Valley fever . LCL3 is identified as a probable endonuclease, suggesting its involvement in nucleic acid metabolism within the fungus . Recombinant production indicates that this protein is synthesized in a host organism, such as bacteria, after the LCL3 gene from C. posadasii is introduced into it .

Expression and Purification

Recombinant LCL3 is produced by expressing the LCL3 gene in a suitable expression system. The expressed protein is then purified using various chromatography techniques to obtain a high degree of purity . The tag type for purification is determined during the production process .

Immunological Properties and Potential Applications

Recombinant LCL3 has potential applications in immunological research related to coccidioidomycosis.

  • ELISA: Recombinant LCL3 can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) for the detection of antibodies against C. posadasii in patient samples . This can aid in the diagnosis of coccidioidomycosis and in monitoring the immune response to infection.

  • Vaccine Development: Immunoreactive proteins like LCL3, could be incorporated into a human vaccine against coccidioidomycosis .

  • Host-Pathogen Interactions: Studying the host immune response to LCL3 can provide insights into the mechanisms of fungal immunity and pathogenesis .

Research Findings and Studies

While specific research focused solely on LCL3 is limited, studies on Coccidioides spp. provide a context for understanding its potential role .

  • Transcriptomic Studies: Transcriptomic analyses of Coccidioides immitis and C. posadasii have identified genes that are differentially expressed during various stages of the fungal life cycle, including spherule formation .

  • Virulence Factors: Research has focused on identifying and characterizing virulence factors in Coccidioides, including cell wall components, enzymes, and proteins involved in nutrient acquisition and immune evasion .

  • Genetic Studies: Studies of Coccidioides have revealed a high degree of genetic diversity between different isolates, which may contribute to variations in virulence and disease outcome .

  • Carbohydrate Metabolism: Enrichment of genes in complex carbohydrate pathways seems plausible since extensive remodeling and synthesis of new cell walls must be required for transformation into and growth of spherules and endospores .

Future Directions

Further research is needed to fully understand the function of LCL3 in C. posadasii and its potential as a diagnostic or therapeutic target. Key areas for future investigation include:

  • Functional Characterization: Determining the specific enzymatic activity of LCL3 and its substrates.

  • Structural Studies: Resolving the three-dimensional structure of LCL3 to gain insights into its mechanism of action.

  • Immunogenicity Studies: Evaluating the ability of LCL3 to elicit a protective immune response in animal models.

  • Clinical Significance: Assessing the potential of LCL3 as a diagnostic marker for coccidioidomycosis.

Table of Upregulated Genes

NameBkg count aResult count bFold enrichmentOdds ratiop-value (Bonferroni)
UDP-sugars interconversion39812.8519.884.17E-05
L-galactose degradation36712.1818.014.40E-04
UDP-L-rhamnose biosynthesis36712.1818.014.40E-04
UDP- N-acetyl-α-D-fucosamine biosynthesis36712.1818.014.40E-04
lactose degradation II36712.1818.014.40E-04
L-sorbose degradation36712.1818.014.40E-04

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes if needed. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure the contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of your specific tag requirements. We will prioritize development of the specified tag when possible.
Synonyms
LCL3; CPC735_070340; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Coccidioides posadasii (strain C735) (Valley fever fungus)
Target Names
LCL3
Target Protein Sequence
MKWLFWASPPQDDSNSNSGAASQVKCRNNENVDVPAPSNAAPPSDRTISKVQSSSRDWNS IVNATDWKQFTEPRTIIPTALVTGGILLCVHIHRKYLRRIPEAGHISPSFFRRRSLLGKV TSVGDGDNFRMYHTPGGKLGGWEWWRKVPTGKNELKNRTIHVRLAGVDAPELPHFGRPAQ PFSQEAHSWLTNYILGRRVRAHLYRPDQYGRVVATVYVRRWLFFRQDVGLQMLKHGLATV YEAKTGVEFGGVELERQYREAEACAKKKGKGMWKALKGGTKGEWESPREYKTRMAAEEGQ KKNARGITRKK
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Coccidioides posadasii and how does it relate to human disease?

Coccidioides posadasii is a soil-dwelling dimorphic fungus found in North and South America that causes the respiratory disease coccidioidomycosis, also known as Valley Fever. Inhalation of aerosolized asexual conidia can result in asymptomatic, acute, or chronic respiratory infection, with approximately 350,000 new infections occurring annually in the United States . The fungus undergoes a unique developmental cycle where it transforms from environmental mycelia to parasitic spherules within the host. During infection, C. posadasii forms specialized parasitic spherules containing endospores that are released upon spherule rupture, a characteristic unique to the Coccidioides genus among fungal pathogens . The disease can range from mild to severe, and is frequently characterized either as a persistent disease requiring months to resolve or as an essentially asymptomatic infection that can reactivate years later, particularly in immunocompromised individuals .

How does LCL3 compare to other characterized fungal endonucleases?

While direct comparative studies between LCL3 and other fungal endonucleases are not explicitly detailed in the available literature, fungal endonucleases generally serve diverse functions across species. Unlike well-characterized fungal endonucleases such as those involved in mating-type switching in Saccharomyces cerevisiae or DNA repair mechanisms in model organisms, the probable endonuclease LCL3 in C. posadasii remains largely uncharacterized functionally. Fungal pathogens often employ nucleases in various cellular processes including genome maintenance, stress responses, and potentially in host-pathogen interactions. The unique lifecycle of Coccidioides, featuring specialized parasitic spherules containing endospores, suggests that LCL3 may have evolved specialized functions related to this distinctive development process . Comparative genomics and proteomics approaches would be valuable for identifying structural and functional homologs in other fungi, potentially revealing conserved domains or novel features specific to the Coccidioides genus.

What are the recommended methods for working with recombinant LCL3 protein?

When working with recombinant Coccidioides posadasii Probable endonuclease LCL3, researchers should employ expression systems that have been optimized for fungal proteins. Based on approaches used for similar proteins, bacterial expression systems using E. coli BL21(DE3) with vectors such as pET28b have proven effective for expressing recombinant proteins from Coccidioides species . Researchers should consider codon optimization for the expression host to improve protein yield, as direct expression of fungal genes in bacterial systems may encounter codon usage bias challenges. Purification protocols typically involve immobilized metal affinity chromatography (IMAC) using histidine tags, followed by size exclusion chromatography to obtain highly purified protein preparations. Activity assays should be conducted under various pH and temperature conditions to determine optimal enzymatic parameters, with special attention to metal ion requirements, as many endonucleases are metalloenzymes. Biosafety considerations are paramount when working with proteins from BSL-3 pathogens like C. posadasii, requiring proper containment facilities and inactivation procedures for all waste materials.

How can researchers effectively study LCL3 function in the context of fungal pathogenesis?

To effectively study LCL3 function in fungal pathogenesis, researchers should employ a multi-faceted approach combining genetic manipulation, protein characterization, and infection models. Gene deletion or knockdown strategies using CRISPR-Cas9 or RNAi techniques would help establish the role of LCL3 in C. posadasii virulence, similar to approaches used with chitinase genes in the development of attenuated strains . Expression analysis using RNA-Seq or NanoString technology can determine when and where LCL3 is expressed during the infection cycle, particularly during critical transition points such as spherule formation and endosporulation . In vitro enzyme assays using purified recombinant protein can characterize the biochemical activity and substrate specificity of LCL3. Researchers should also develop fluorescently tagged versions of LCL3 for localization studies during infection. Animal models of coccidioidomycosis can then be used to compare wild-type and LCL3-deficient strains, assessing differences in fungal burden, dissemination, and host immune responses to determine the contribution of LCL3 to pathogenesis.

What gene manipulation techniques are most effective for studying LCL3 in Coccidioides posadasii?

For studying LCL3 in Coccidioides posadasii, researchers must carefully select gene manipulation techniques that overcome the challenges of working with this dimorphic fungal pathogen. Targeted gene deletion using homologous recombination remains valuable but can be labor-intensive with often low efficiency in Coccidioides species. The more recent CRISPR-Cas9 system has demonstrated improved efficiency for gene editing in filamentous fungi and could be optimized for C. posadasii. Conditional expression systems, such as tetracycline-inducible promoters, are particularly useful for studying essential genes, allowing researchers to control LCL3 expression and observe phenotypic consequences. Complementation studies, where the LCL3 gene is reintroduced into a deletion mutant, are crucial for confirming that observed phenotypes are specifically due to LCL3 absence rather than off-target effects . For functional validation, researchers should consider heterologous expression of LCL3 in model fungi like Saccharomyces cerevisiae to assess activity in a simplified system before studying it in the more complex C. posadasii background.

How might LCL3 contribute to immune evasion mechanisms of C. posadasii?

The probable endonuclease LCL3 may contribute to immune evasion mechanisms of C. posadasii through several potential pathways, though specific functions remain to be fully characterized. Based on known fungal pathogen strategies, LCL3 could participate in nucleic acid modification processes that alter pathogen-associated molecular patterns (PAMPs), thereby reducing recognition by host pattern recognition receptors. Similar to the documented role of the metalloproteinase Mep1 in C. posadasii, which digests the immunodominant cell surface antigen SOWgp to prevent host recognition of endospores, LCL3 might target specific nucleic acid structures that would otherwise trigger immune responses . As an endonuclease, LCL3 could potentially degrade neutrophil extracellular traps (NETs), which contain DNA and antimicrobial proteins released by neutrophils to capture and kill pathogens. The timing of LCL3 expression during the parasitic cycle could be particularly relevant, as C. posadasii is known to employ specific evasion strategies during spherule remodeling and endospore formation, which are critical stages for pathogen survival and dissemination within the host .

What is the potential of LCL3 as a therapeutic target or vaccine candidate?

LCL3 could represent a promising therapeutic target or vaccine candidate for coccidioidomycosis due to several factors that warrant investigation. If LCL3 proves essential for C. posadasii survival or virulence, inhibitors specifically targeting this endonuclease could disrupt critical fungal processes while minimizing off-target effects on human cells. Similar approaches targeting unique fungal enzymes have shown success in antifungal drug development for other mycoses . As a potential vaccine component, recombinant LCL3 could stimulate protective immunity if it elicits strong T-cell responses, which are critical for controlling coccidioidal infections. Research into attenuated vaccine strains of C. posadasii, such as the Δcts2/Δard1/Δcts3 mutant that cannot complete endospore development, demonstrates the feasibility of targeting specific developmental stages for vaccine development . If LCL3 contains epitopes unique to Coccidioides species, it could serve as a specific diagnostic marker, improving the often challenging diagnosis of coccidioidomycosis. Development strategies should include computational approaches like those used for other fungal targets, including homology modeling and virtual screening to identify potential inhibitors .

How might LCL3 interact with host cellular components during infection?

The interaction between LCL3 and host cellular components during infection represents a complex area of investigation that could reveal important pathogenicity mechanisms. As an endonuclease, LCL3 potentially interacts with host nucleic acids if secreted or released during infection, possibly degrading host DNA or RNA to disrupt cellular functions or immune signaling pathways. The enzyme might target specific host nucleic acid structures involved in immune response gene regulation, thereby modulating the inflammatory response to favor pathogen survival. LCL3 could potentially be recognized by host pattern recognition receptors, triggering specific immune responses that the pathogen has evolved to counter through additional virulence factors. Alternatively, LCL3 might act primarily on fungal nucleic acids during critical morphological transitions, indirectly affecting host-pathogen interactions by enabling the dramatic remodeling seen during spherule formation and endosporulation . Studies utilizing techniques like yeast two-hybrid screening, co-immunoprecipitation, or proximity labeling could help identify host proteins that interact with LCL3, providing insights into its role during the infection process.

What are the major challenges in studying LCL3 function in vivo?

Studying LCL3 function in vivo presents significant challenges that researchers must overcome to fully understand its role in Coccidioides pathogenesis. The primary obstacle is biosafety concerns, as C. posadasii is a BSL-3 pathogen requiring specialized containment facilities and trained personnel, limiting the number of institutions that can conduct such research . The complex, biphasic lifecycle of Coccidioides complicates experimental design, as researchers must account for different morphological forms and their distinct gene expression patterns. Creating gene deletion mutants in Coccidioides is technically challenging compared to model fungi, with lower transformation efficiency and homologous recombination rates. The unique parasitic spherule phase is difficult to recreate in vitro, often requiring sophisticated culture conditions or animal models to study genes specifically expressed during this critical stage. Determining the precise timing of LCL3 expression and activity during infection requires multiple time points and sophisticated in vivo imaging techniques. Additionally, redundancy in fungal endonuclease function may mask phenotypes in single-gene deletion studies, necessitating multiple gene knockouts or conditional expression systems to fully elucidate LCL3's contribution to pathogenesis.

How can transcriptomic and proteomic approaches enhance our understanding of LCL3 function?

Transcriptomic and proteomic approaches offer powerful tools for elucidating LCL3 function within the broader context of Coccidioides posadasii biology. RNA-Seq analysis comparing gene expression profiles between wild-type and LCL3 mutant strains can reveal co-regulated genes and affected pathways, similar to approaches used to identify approximately 280 differentially regulated transcripts in the Δcts2/Δard1/Δcts3 mutant . NanoString technology, which allows for precise quantification of selected transcripts in small samples, can be used to validate expression patterns of LCL3 and related genes in an in vivo model, providing greater sensitivity for low-abundance transcripts . Proteomic analysis using mass spectrometry can identify post-translational modifications of LCL3 that might regulate its activity during different developmental stages. Comparative proteomics between spherules and mycelia can place LCL3 within protein interaction networks specific to the parasitic phase. Metabolomic approaches, such as volatile organic compound analysis using solid phase microextraction and comprehensive two-dimensional gas chromatography-time-of-flight mass spectrometry (GC × GC-TOFMS), can reveal metabolic changes in LCL3 mutants compared to wild-type strains, potentially connecting LCL3 function to specific metabolic pathways .

What potential applications exist for LCL3 in comparative genomics of pathogenic fungi?

LCL3 offers valuable opportunities for comparative genomics studies across pathogenic fungi, potentially revealing evolutionary patterns in virulence mechanisms. Researchers can use LCL3 sequence analysis to investigate selective pressures on nuclease genes in fungal pathogens, determining whether these enzymes represent conserved virulence factors or species-specific adaptations. Comparing the genomic context of LCL3 with similar endonucleases in other pathogenic fungi could identify conserved gene clusters suggesting functional relationships or co-regulation. This approach is particularly valuable given that 49% of Coccidioides genes are hypothetical with unknown function, making comparative approaches essential for functional prediction . Phylogenetic analysis of LCL3 homologs across fungal species can trace the evolutionary history of this enzyme family and identify structural features unique to Coccidioides that might relate to its specialized parasitic lifestyle. Of particular interest would be comparing LCL3 with nucleases in other dimorphic fungal pathogens like Histoplasma or Blastomyces to determine if similar enzymes contribute to morphological transitions across these species. Additionally, identification of structural differences between fungal and human nucleases could guide the development of selective inhibitors with therapeutic potential.

What are the optimal conditions for expressing and purifying recombinant LCL3?

The optimal conditions for expressing and purifying recombinant LCL3 should be carefully established through systematic optimization. Based on approaches used for other Coccidioides proteins, E. coli BL21(DE3) expression systems with pET28b vectors have shown success, though researchers should evaluate multiple expression systems including yeast-based options like Pichia pastoris that may better handle fungal protein folding . Expression should be tested under various induction conditions, varying IPTG concentration (typically 0.1-1.0 mM), temperature (16-37°C), and duration (4-24 hours), with lower temperatures often favoring proper folding of eukaryotic proteins in bacterial systems. For purification, a two-step approach is recommended, beginning with immobilized metal affinity chromatography using histidine tags, followed by size exclusion chromatography to remove aggregates and achieve high purity. Buffer optimization is critical for maintaining enzyme stability, with various pH ranges (pH 6.0-8.0) and salt concentrations (100-500 mM NaCl) being systematically tested. Addition of glycerol (5-10%) and reducing agents like DTT or β-mercaptoethanol may enhance protein stability during storage. For functional studies, researchers should determine metal ion requirements (commonly Mg²⁺, Mn²⁺, or Zn²⁺) and optimal reaction conditions for nuclease activity using various DNA/RNA substrates to characterize specificity.

How can researchers effectively assess LCL3 interactions with host immune components?

To effectively assess LCL3 interactions with host immune components, researchers should implement a comprehensive experimental strategy combining in vitro, ex vivo, and in vivo approaches. Purified recombinant LCL3 can be used in binding assays with host immune cells (macrophages, neutrophils, dendritic cells) to determine direct interactions, with flow cytometry and confocal microscopy used to track localization. Cytokine profiling of immune cells exposed to recombinant LCL3 can reveal immunomodulatory effects, while transcriptome analysis of these cells can identify signaling pathways activated or suppressed by the enzyme. Neutrophil extracellular trap (NET) degradation assays would be particularly relevant if LCL3 is hypothesized to target host DNA as an immune evasion strategy, similar to mechanisms employed by other pathogens . For ex vivo studies, lung tissue explants can be exposed to wild-type and LCL3-deficient Coccidioides to observe differences in tissue invasion and immune cell recruitment. In vivo imaging using fluorescently tagged LCL3 in mouse models can track the enzyme's distribution during infection, while comparison of immune responses to wild-type and LCL3-deficient strains can reveal the enzyme's contribution to pathogenesis, building on approaches used to study other C. posadasii virulence factors .

What bioinformatic tools are most valuable for analyzing LCL3 structure and function?

Bioinformatic analysis of LCL3 structure and function requires a multifaceted approach using various computational tools to generate meaningful hypotheses for experimental validation. Sequence analysis tools like BLAST and HMMER can identify homologs across species, while multiple sequence alignment using MUSCLE or CLUSTALW can highlight conserved catalytic residues and domains. Protein structure prediction using AlphaFold2 or I-TASSER can generate three-dimensional models of LCL3, which can then be refined through molecular dynamics simulations to understand flexibility and potential substrate binding sites. Docking simulations can predict interactions between LCL3 and potential nucleic acid substrates or small molecule inhibitors, similar to approaches used in virtual screening for other fungal targets . Specialized nuclease prediction servers can help identify catalytic motifs and predict cleavage preferences. Gene co-expression network analysis using transcriptomic data can place LCL3 in the context of related genes that may be co-regulated during specific developmental stages or stress responses . Structural comparison with human nucleases using tools like DALI can identify unique features that might be exploited for selective inhibitor design. Together, these bioinformatic approaches can generate testable hypotheses about LCL3 function that guide experimental design and potentially accelerate therapeutic development.

How could LCL3 be targeted in novel antifungal drug development?

Targeting LCL3 in novel antifungal drug development presents several promising strategies based on approaches used for other enzymatic targets. Structure-based drug design, utilizing crystal structures or computational models of LCL3, can identify unique binding pockets absent in human nucleases, enabling the design of selective inhibitors through virtual screening of chemical libraries . High-throughput screening assays measuring LCL3 enzymatic activity can be developed to test large compound collections, with hits further optimized through medicinal chemistry approaches. Allosteric inhibitors targeting regulatory sites rather than the catalytic center might offer greater selectivity by exploiting structural features unique to fungal nucleases. Peptide-based inhibitors designed to mimic natural interaction partners could disrupt protein-protein interactions essential for LCL3 function. RNA interference or antisense oligonucleotides specifically targeting LCL3 mRNA represent genetic approaches to inhibition, though delivery systems for these modalities in fungal cells remain challenging. Drug repurposing screens using approved nuclease inhibitors from other therapeutic areas could accelerate development timelines. Combination strategies targeting LCL3 alongside established antifungal targets might achieve synergistic effects and reduce resistance development, addressing a critical need given the limited antifungal arsenal currently available for treating invasive fungal infections like coccidioidomycosis .

What molecular features of LCL3 might make it a good vaccine candidate?

Several molecular features of LCL3 could potentially make it a valuable vaccine candidate against coccidioidomycosis, though careful evaluation is necessary. If LCL3 contains T-cell epitopes capable of stimulating robust cell-mediated immunity, it could induce protective responses, as cell-mediated immunity is critical for controlling Coccidioides infections. The protein's potential role in virulence means that neutralizing antibodies against LCL3 might impair the pathogen's ability to establish infection or disseminate within the host. If LCL3 is expressed consistently across different Coccidioides strains and during multiple lifecycle stages, it could provide broad protection against various isolates and throughout the infection process. The protein's uniqueness to Coccidioides species would minimize cross-reactivity with human proteins or commensal fungi, reducing the risk of autoimmunity or disruption of beneficial microbiota. Recombinant LCL3 could be produced at scale for vaccine development, similar to other recombinant Coccidioides proteins that have been investigated as immunogens . Combination vaccine approaches incorporating LCL3 with other Coccidioides antigens might provide more comprehensive protection than single-antigen vaccines, building on research with attenuated strains like Δcts2/Δard1/Δcts3 that has shown promising results in animal models .

How does understanding LCL3 contribute to broader antifungal resistance research?

Understanding LCL3 contributes significantly to broader antifungal resistance research by potentially revealing novel mechanisms and targets for intervention. If LCL3 participates in stress responses or DNA repair pathways, it might influence how Coccidioides adapts to antifungal pressure, with implications for resistance development. Studying LCL3 regulation could reveal signaling networks that coordinate multiple resistance mechanisms, providing insights applicable to other fungal pathogens with similar regulatory systems. As a potentially unique target absent in model fungi like Candida or Aspergillus, LCL3 represents an opportunity to expand the repertoire of antifungal targets beyond the limited set currently exploited by available drugs . Comparative analysis of LCL3 across clinical isolates with varying drug susceptibility profiles might identify polymorphisms associated with intrinsic or acquired resistance. Integration of LCL3 research with broader studies on fungal stress responses and adaptation could reveal how pathogens balance virulence and resistance mechanisms under selective pressure. This knowledge aligns with current antifungal development approaches seeking to identify unique fungal targets that reduce the risk of resistance development, addressing a critical need given the increasing prevalence of antifungal resistance and the limited therapeutic arsenal currently available for invasive fungal infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.