Recombinant Coccidioides posadasii Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Description

Introduction to GET1 and Coccidioides posadasii

  • GET1: In yeast, GET1 is part of the GET complex, which plays a crucial role in the insertion of tail-anchored (TA) proteins into the endoplasmic reticulum (ER) membrane. The GET complex, including GET1 and GET2, facilitates the targeting and integration of TA proteins, which are essential for various cellular processes .

  • Coccidioides posadasii: This fungus is one of the causative agents of coccidioidomycosis, a serious respiratory disease. Research on Coccidioides posadasii often focuses on its pathogenicity factors and potential vaccine candidates .

Proteins of Coccidioides posadasii

Several proteins from Coccidioides posadasii have been studied for their roles in pathogenicity and potential use as diagnostic or vaccine antigens:

  • Chitinase (CTS1): Expressed in Uncinocarpus reesii, this protein shows serodiagnostic efficacy for coccidioidomycosis .

  • Metalloproteinase (Mep1): Contributes to the pathogenicity of Coccidioides posadasii by facilitating evasion of host immune responses .

  • β-1,3-Glucanosyltransferase (Gel1): This protein has been explored as a potential vaccine candidate due to its protective efficacy in mouse models .

Data Table: Proteins of Coccidioides posadasii

ProteinFunction/RoleReference
Chitinase (CTS1)Serodiagnostic antigen for coccidioidomycosis
Metalloproteinase (Mep1)Pathogenicity determinant
β-1,3-Glucanosyltransferase (Gel1)Potential vaccine candidate

Future Research Directions

  1. Exploring GET1 Homologs in Fungi: Investigating whether Coccidioides posadasii or other fungi have homologs of the GET1 protein could provide insights into their cellular processes.

  2. Pathogenicity Factors: Continuing research on proteins like Mep1 and Gel1 could lead to better understanding of Coccidioides pathogenicity and vaccine development.

  3. Protein Expression Systems: Developing efficient systems for expressing Coccidioides proteins, similar to the use of Uncinocarpus reesii for CTS1, could aid in producing diagnostic and therapeutic agents .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; CPC735_002340; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Coccidioides posadasii (strain C735) (Valley fever fungus)
Target Names
GET1
Target Protein Sequence
MPSLLIIVLIIHVVTYLINTIGANTIDSLLWLLYLKLPNQTSQTADEQRRLKREVMQLKR EMNATSSQDEFAKWAKLRRRHDKTMEEYEAKNKALGKHKSSFDLAVKSVRFFSTTGLKLF LQFWFSKTPIFELPRGWIPWQVEWVLSFPRAPLGTVSIQIWGGVCATVVSLAGDAIGVVN VYLTSKAPKQKEPATSGENSARPMAIKKEL
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant C. posadasii GET1 protein?

The most commonly documented expression system for recombinant C. posadasii GET1 is Escherichia coli . The methodology involves:

  • Gene cloning: Amplification of the GET1 coding sequence from C. posadasii genomic DNA or cDNA.

  • Vector construction: Insertion into an appropriate expression vector containing elements such as:

    • A strong promoter

    • Fusion tags (commonly His-tag)

    • Selection markers

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay lack post-translational modifications present in native protein
Expi293F cellsMammalian system allowing proper folding and modificationsHigher cost, potentially lower yield (~50 mg/L)
HeLa cellsMammalian system, stable transfection possibleLower yield reported for similar recombinant proteins

For researchers requiring high protein purity with proper folding, a methodology similar to that used for other recombinant proteins in Expi293F human cell lines may be adapted, involving:

  • Fusion with rabbit IgG light chain for enhanced secretion

  • Incorporation of a TEV protease cleavage site

  • C-terminal His-tag for purification

  • Purification via chromatography methods

This approach has demonstrated yields of approximately 50 mg/liter for similar recombinant proteins .

What are the optimal storage and handling conditions for recombinant GET1 protein?

Proper storage and handling are critical for maintaining recombinant GET1 protein integrity and activity. Based on established protocols for similar recombinant proteins, the following guidelines should be implemented:

For lyophilized recombinant GET1:

  • Store at -20°C to -80°C for up to 12 months

  • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (typically 50%) for long-term storage

For reconstituted protein:

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • Long-term storage should be at -20°C to -80°C, with expected shelf life of approximately 6 months

Methodological considerations for handling include:

  • Minimizing freeze-thaw cycles, as repeated freezing and thawing can compromise protein integrity

  • Using appropriate buffer systems for intended experimental applications

  • Considering addition of protease inhibitors if proteolytic degradation is a concern

  • Validating protein stability under specific experimental conditions prior to critical experiments

What methodological approaches are recommended for studying GET1 protein interactions and function?

To investigate GET1 protein interactions and functions, multiple complementary approaches should be considered:

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation (Co-IP) using anti-His tag antibodies or specific anti-GET1 antibodies

  • Yeast two-hybrid screening to identify potential binding partners

  • Surface plasmon resonance (SPR) for measuring binding kinetics

  • Proximity labeling approaches (BioID or APEX) for identifying proximal proteins in cellular contexts

Functional Characterization:

  • Targeted gene disruption or RNA interference to assess phenotypic effects

  • Heterologous expression systems to reconstitute GET1 function

  • In vitro transport assays to assess role in protein targeting pathways

TechniqueApplicationMethodological Considerations
ImmunoblottingProtein detectionSimilar to methods used for other Coccidioides proteins: SDS-PAGE separation, transfer to membrane, and detection with human or mouse sera that recognize C. posadasii proteins
Proteomic AnalysisIdentification and characterizationMass spectrometry approaches including CID mass spectra analysis, with computational matching to database sequences using tools like TurboSEQUEST
Bioinformatic AnalysisStructural and functional predictionUtilize tools like BLAST for sequence similarity analysis, hydropathicity profile analysis, GPI-SOM algorithm for GPI anchor prediction, and WoLF PSORT II for signal peptide prediction and cellular localization

For experimental designs, researchers should incorporate appropriate controls:

  • Wild-type Coccidioides strains

  • GET1 knockout/knockdown strains

  • Cells expressing mutated versions of GET1 with alterations in key functional domains

What structural analysis approaches would be most informative for understanding GET1 protein?

Structural analysis of recombinant GET1 protein can provide valuable insights into its function and potential as a therapeutic target. The following methodological approaches are recommended:

Computational Structure Prediction:

  • Homology modeling using related proteins with known structures

  • Ab initio modeling approaches for regions lacking homology to known structures

  • Molecular dynamics simulations to investigate conformational dynamics

Experimental Structure Determination:

  • X-ray crystallography of purified GET1 protein or functional domains

  • Cryo-electron microscopy (Cryo-EM) for visualization of GET1 in complex with interacting partners

  • Nuclear magnetic resonance (NMR) spectroscopy for solution structure determination of smaller domains

For sequence analysis and structure prediction, researchers should employ:

  • BLAST searches against Swiss-Prot/TrEMBL database and NCBI nonredundant protein database

  • PROSITE algorithm for identification of conserved motifs

  • Hydropathicity profile analysis to identify membrane-spanning regions

  • GPI-SOM algorithm for detection of potential GPI anchor sites

The predicted structural features of GET1 should be correlated with functional analyses to understand structure-function relationships, particularly in the context of protein targeting pathways and potential roles in C. posadasii pathogenicity.

What are the key considerations when designing immunological studies involving recombinant GET1?

When designing immunological studies with recombinant GET1, researchers should consider:

Antigenicity Assessment:

  • Evaluate immunoreactivity using sera from patients with confirmed coccidioidal infection

  • Compare reactivity patterns with sera from experimentally infected animal models

  • Identify immunodominant epitopes using epitope mapping techniques

Methodological Approach for Serological Testing:

  • Expression and purification of full-length GET1 with minimal contamination

  • Development of ELISA or other immunoassays using the recombinant protein

  • Validation against established serological methods for Coccidioides detection

Similar approaches have been successfully employed for other Coccidioides proteins, where immunoblot analysis was conducted using:

  • Pooled sera from surviving mice vaccinated with cell wall extracts

  • Pooled human sera from patients with confirmed coccidioidal infection

  • Goat anti-human IgG-specific secondary antibody for detection

Research Applications:

  • Assessment of GET1 as a potential diagnostic marker

  • Evaluation of GET1 as a candidate vaccine antigen

  • Investigation of humoral immune responses targeting GET1 during infection

Careful consideration should be given to cross-reactivity with proteins from related fungi and potential variability in immune recognition among different patient populations.

What technical challenges exist in purifying high-quality recombinant GET1 and how can they be addressed?

Purifying high-quality recombinant GET1 presents several technical challenges that researchers should anticipate and address:

Challenge 1: Protein Solubility and Folding

  • Solution: Screen multiple buffer conditions during purification

  • Methodological approach: Test various detergents, salt concentrations, and pH values to optimize solubility

  • Consider fusion tags (e.g., MBP, GST) that enhance solubility while maintaining a cleavable linker

Challenge 2: Achieving High Purity

  • Solution: Implement multi-step purification strategy

  • Methodological approach: Combine affinity chromatography (using His-tag) with size exclusion and/or ion exchange chromatography

  • For enhanced results, consider the approach used for other recombinant proteins using:

    • Fusion with IgG light chain to improve secretion

    • TEV protease cleavage to remove fusion tag

    • Optimized chromatography conditions

Challenge 3: Maintaining Protein Stability

  • Solution: Determine optimal buffer formulation for storage

  • Methodological approach: Evaluate protein stability in different buffer systems containing various stabilizing agents

  • Consider addition of glycerol (5-50%) for long-term storage

Challenge 4: Ensuring Biological Activity

  • Solution: Develop functional assays to verify activity

  • Methodological approach: Compare activity of recombinant protein with native protein when possible

  • Verify structural integrity using circular dichroism or other biophysical methods

How should researchers design experiments to compare recombinant GET1 with native protein?

When comparing recombinant GET1 with native protein from C. posadasii, researchers should implement a comprehensive experimental design:

Extraction of Native GET1:

  • Cell wall isolation from C. posadasii spherules using established protocols

  • Protein extraction using Triton X-114 detergent phase separation

  • Initial separation by SDS-PAGE and protein identification by immunoblotting

Comparative Analysis:

  • Side-by-side biochemical characterization:

    • SDS-PAGE for molecular weight comparison

    • Western blotting using GET1-specific antibodies

    • Mass spectrometry for peptide mapping and post-translational modification analysis

  • Functional comparison:

    • Assess binding to known interacting partners

    • Compare enzymatic activities if applicable

    • Evaluate immunoreactivity with patient sera

  • Structural comparison:

    • Circular dichroism for secondary structure comparison

    • Limited proteolysis to assess domain organization and stability

    • Thermal stability measurements

Data Analysis and Interpretation:

  • Statistical methods should include multiple biological replicates

  • Quantitative analyses should be performed when possible, with appropriate controls

  • Researchers should acknowledge limitations in the experimental design and potential differences between recombinant and native proteins

What approaches can be used to investigate the role of GET1 in C. posadasii pathogenesis?

To investigate the contribution of GET1 to C. posadasii virulence and pathogenesis, researchers should consider a multi-faceted approach:

Genetic Manipulation Strategies:

  • Gene deletion or disruption using CRISPR/Cas9 or traditional homologous recombination methods

  • Conditional gene expression systems to regulate GET1 expression

  • Site-directed mutagenesis to alter specific functional domains

In Vitro Infection Models:

  • Cell culture-based infection assays using relevant host cells (e.g., macrophages, lung epithelial cells)

  • Assessment of adhesion, invasion, and intracellular survival

  • Evaluation of host cell responses to wild-type versus GET1-mutant strains

In Vivo Studies:

Immunological Approaches:

  • Assessment of GET1 recognition by host pattern recognition receptors

  • Evaluation of GET1 as a target for protective immunity

  • Investigation of GET1-specific antibody and T cell responses during infection

Similar approaches have been successfully employed for other C. posadasii proteins, including aspartyl proteases and β-1,3-glucanosyltransferases . These methodologies can be adapted for GET1 studies to understand its role in the pathogenesis of coccidioidomycosis.

How should researchers interpret discrepancies between in silico predictions and experimental data for GET1?

When faced with discrepancies between computational predictions and experimental results for GET1 protein, researchers should follow a systematic approach to resolve these contradictions:

Methodological Steps for Resolution:

  • Re-evaluate computational predictions using:

    • Multiple prediction algorithms and tools

    • Updated database information

    • Consideration of algorithm limitations for fungal proteins

  • Verify experimental findings through:

    • Independent experimental replication

    • Alternative methodological approaches

    • Additional controls to rule out technical artifacts

  • Reconcile discrepancies by:

    • Considering biological contexts not accounted for in computational models

    • Examining species-specific adaptations in C. posadasii

    • Investigating potential post-translational modifications affecting function

Common Sources of Discrepancy:

  • Prediction algorithms trained primarily on model organisms rather than fungi

  • Unique structural features of fungal proteins not well-represented in databases

  • Post-translational modifications present in native protein but absent in recombinant versions

  • Technical limitations in experimental approaches affecting protein conformation or function

For computational analysis of GET1, researchers should employ multiple tools, similar to approaches used for other C. posadasii proteins:

  • BLAST searches against multiple databases

  • Hydropathicity profile analysis

  • Specialized algorithms for fungal protein prediction

What are best practices for validating antibodies against recombinant GET1 for research applications?

Validating antibodies against recombinant GET1 is critical for ensuring reliable experimental results. Researchers should implement the following comprehensive validation workflow:

Specificity Testing:

  • Western blotting against:

    • Purified recombinant GET1

    • C. posadasii cell lysates

    • Cell lysates from related fungal species

    • Lysates from GET1 knockout strains (negative control)

  • Immunoprecipitation followed by mass spectrometry to confirm target identity

  • Immunofluorescence with appropriate controls:

    • GET1-expressing cells versus non-expressing cells

    • Peptide competition assays

    • Secondary antibody-only controls

Performance Validation:

  • Titration experiments to determine optimal antibody concentration

  • Assessment of lot-to-lot variability

  • Evaluation of performance across different experimental applications

Validation Documentation:

  • Detailed recording of validation experiments

  • Transparent reporting of antibody specifications

  • Documentation of optimal conditions for various applications

Similar methodological approaches have been successfully employed for antibody validation against other Coccidioides proteins, where immunoblot analysis demonstrated specific recognition of target proteins by both murine and human sera .

What emerging technologies could advance our understanding of GET1 structure and function?

Emerging technologies and methodological innovations offer exciting opportunities to enhance our understanding of GET1 protein:

Advanced Structural Biology Approaches:

  • Cryo-electron tomography for visualizing GET1 in its native cellular environment

  • Single-particle cryo-EM for high-resolution structure determination

  • Integrative structural biology combining multiple data sources (X-ray, NMR, EM, crosslinking mass spectrometry)

  • AlphaFold2 and other AI-based structure prediction methods for generating high-confidence structural models

Functional Genomics and Systems Biology:

  • CRISPR interference/activation for precise modulation of GET1 expression

  • High-throughput interactome mapping using BioID or APEX proximity labeling

  • Global genetic interaction mapping through synthetic genetic array analysis

  • Multi-omics approaches to contextualize GET1 function within cellular networks

Advanced Imaging Techniques:

  • Super-resolution microscopy for visualizing GET1 localization and dynamics

  • Live-cell imaging using fluorescent protein fusions to track GET1 trafficking

  • Correlative light and electron microscopy (CLEM) to combine functional and ultrastructural data

These methodological advances will enable researchers to address fundamental questions about GET1 biology that have been challenging to approach with conventional techniques. Implementing these approaches requires careful experimental design and appropriate controls to ensure robust, reproducible results.

How might GET1 research contribute to diagnostics or therapeutics for coccidioidomycosis?

Research on recombinant GET1 protein has potential translational applications for improving diagnosis and treatment of coccidioidomycosis:

Diagnostic Applications:

  • Development of GET1-based serological assays:

    • ELISA or lateral flow assays for antibody detection

    • Multiplex assays combining GET1 with other immunoreactive proteins

    • Point-of-care diagnostic tools for resource-limited settings

  • GET1 as a biomarker for disease progression:

    • Assessment of GET1-specific antibody titers during infection

    • Correlation with clinical outcomes and treatment response

    • Differentiation between active and resolved infection

Therapeutic Applications:

  • GET1 as a vaccine candidate:

    • Evaluation of recombinant GET1 in protective immunity

    • Design of subunit vaccines targeting immunodominant epitopes

    • Combination with appropriate adjuvants to enhance efficacy

  • Drug target potential:

    • High-throughput screening for GET1 inhibitors

    • Structure-based drug design targeting critical GET1 functional domains

    • Assessment of GET1 inhibition on C. posadasii growth and virulence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.