Recombinant Cocksfoot mottle virus Replicase polyprotein P2AB (ORF2A-2B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cocksfoot Mottle Virus Replicase Polyprotein P2AB (ORF2A-2B)

Cocksfoot mottle virus (CfMV) is a plant virus belonging to the genus Sobemovirus. It contains a single-stranded, positive-sense RNA genome that encodes several proteins essential for its replication and survival. Among these proteins, the replicase polyprotein P2AB, encoded by overlapping open reading frames ORF2A and ORF2B, plays a crucial role in viral replication. This article will delve into the recombinant form of this polyprotein, focusing on its structure, function, and research findings.

Structure and Function of P2AB Polyprotein

The P2AB polyprotein is a product of the translation of ORF2A and ORF2B. The translation of ORF2B requires a –1 programmed ribosomal frameshifting (PRF) event, which occurs with an efficiency of approximately 10% to 20% in CfMV . This frameshifting allows the synthesis of the full-length replicase complex necessary for viral RNA replication.

Key Components of P2AB:

  • Serine Proteinase: Located within the P2A sequence, this enzyme is responsible for the proteolytic processing of the polyprotein into functional proteins .

  • VPg (Genome-Linked Protein): A 12 kDa protein attached to the viral RNA, involved in the initiation of viral replication .

  • Replicase: Encoded primarily by ORF2B, this enzyme is crucial for the replication of the viral genome .

Recombinant P2AB Polyprotein

Recombinant forms of the P2AB polyprotein are produced through genetic engineering techniques, allowing researchers to study its components and functions in detail. These recombinant proteins can be expressed in systems like Escherichia coli for further analysis.

Production and Purification:

  • Recombinant proteins are typically produced by cloning the relevant gene sequences into expression vectors.

  • Expression in E. coli followed by purification using techniques such as affinity chromatography.

Proteolytic Processing:

The polyprotein undergoes proteolytic processing at specific sites. The N-terminal sequence of VPg indicates that it is cleaved between glutamic acid and asparagine residues . This processing is crucial for the maturation of functional proteins.

Frameshifting Efficiency:

The efficiency of –1 PRF affects the ratio of P2A to P2AB products, influencing viral replication dynamics .

Role in Viral Replication:

The replicase complex, primarily encoded by ORF2B, is essential for the replication of the viral genome. The efficiency of this process can impact viral load and disease severity.

Table 1: Key Features of P2AB Polyprotein

FeatureDescription
ORFsORF2A and ORF2B
Frameshifting–1 PRF for ORF2B translation
Serine ProteinaseLocated within P2A
VPg12 kDa genome-linked protein
ReplicaseEncoded by ORF2B

Table 2: Proteolytic Processing Sites

SiteAmino Acid SequenceProduct
Site 1VENSRLQPLESSPutative cleavage site
Site 2VENSELYPDQSSN-terminus of VPg

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ORF2A-2B; Replicase polyprotein P2AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
398-942
Protein Length
Full Length of Mature Protein
Species
Cocksfoot mottle virus (isolate Dactylis glomerata/Norway/CfMV-NO/1995) (CfMV)
Target Names
ORF2A-2B
Target Protein Sequence
TAIRPLNLPAGGLPTGQSALGQLIEYAGYVWRDEGIINSNGMPFRSAGKSSCRFREAVCR AVHRDVRAAETEFPELKELAWPSRGSKAEIGSLLFQAGRFERVEAPANLQLAITNLQAQY PRSRPRSCFRREPWCREDFVAEIEKIAHSGEINLKASPGVPLAEIGVSNQQVIDVAWPLV CEAVVERLHALASVDPRQHDWSPEELVKRGLCDPVRLFVKQEPHSRQKIEQGRFRLISSV SLVDQLVERMLFGPQNTTEIALWHSNPSKPGMGLSKASQVALLWEDLARKHQTHPGAMAD ISGFDWSVQDWELWADVSMRIELGSFPALMAKAAISRFYCLMNATFQLTNGELLTQELPG LMKSGSYCTSSSNSRIRCLMAELIGSPWCIAMGDDSVEGWVDDAPRKYSALGHLCKEYEA CPVLPNGDLKEVSFCSHLISKGRAELETWPKCLFRYLSGPHDVESLEMELSSSRRWGQIV RYLRRIGRVSGNDGEERSSNESPATTKTQGSAAAWGPPQEAWPVDGASLSTFEPSSSGWF HLEGW
Uniprot No.

Target Background

Function
This recombinant Cocksfoot mottle virus Replicase polyprotein P2AB (ORF2A-2B) is responsible for cleaving polyproteins P2A and P2AB. It is covalently attached to the 5' end of genomic and subgenomic RNAs, potentially serving as a primer for the replicase, and plays a crucial role in viral genome replication.
Subcellular Location
[Replicase polyprotein P2AB]: Host membrane; Multi-pass membrane protein.; [N-terminal protein]: Host membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of Cocksfoot mottle virus and how does it relate to replicase expression?

The Cocksfoot mottle virus possesses a positive-sense ssRNA genome of 4082 nucleotides with four major open reading frames (ORFs) . Unlike other previously sequenced sobemoviruses such as southern bean mosaic virus (SBMV) and rice yellow mottle virus (RYMV), CfMV demonstrates a distinctive genomic organization .

The viral genome contains:

  • A 5'-untranslated region of 69 nucleotides

  • A 3'-untranslated region of 225 nucleotides

  • Four open reading frames (ORFs)

The expression of the replicase occurs through two overlapping ORFs:

  • ORF2a: Comprises 1710 nucleotides (positions 424-2133) and encodes a protein of 568 amino acids with a calculated molecular mass of 60.8 kDa

  • ORF2b: Located in the -1 reading frame relative to ORF2a

The replicase is translated as part of a polyprotein by -1 ribosomal frameshifting in ORF2a, resulting in a transframe protein with a calculated molecular mass of 103.4 kDa . In vitro translation studies have confirmed that the 100 kDa polyprotein is encoded by ORFs 2a and 2b through this -1 ribosomal frameshift .

This genomic arrangement is crucial for regulating the ratio between viral proteins and ensuring proper viral replication.

What molecular mechanisms enable the expression of CfMV replicase polyprotein?

The CfMV replicase polyprotein P2AB is expressed through a -1 programmed ribosomal frameshifting (-1 PRF) mechanism . This mechanism depends on two critical RNA elements:

  • Slippery heptanucleotide sequence: The specific sequence U UUA AAC serves as the slippery site where the ribosome shifts one nucleotide backward during translation

  • Downstream secondary structure: A stem-loop structure immediately downstream of the slippery sequence consists of:

    • 12 base pairs in the stem

    • A single bulge

    • A tetranucleotide loop

When ribosomes encounter this sequence during translation, a fraction of them shifts backward by one nucleotide at the slippery site, causing a change in the reading frame. This results in the production of two proteins from the same mRNA: the standard translation product from ORF2a alone and the frameshift product containing portions of both ORF2a and ORF2b .

The efficiency of this frameshifting mechanism has been measured in different systems:

  • 14.4 ± 1.9% efficiency in yeast cells

  • 2.4 ± 0.7% efficiency in bacterial cells

Importantly, flanking sequences from the viral context can enhance frameshifting efficiency by approximately 2-fold in both yeast and bacteria compared to the minimal signal alone , suggesting that additional viral sequences contribute to optimal frameshifting regulation.

What methodologies are used to produce and purify recombinant CfMV replicase polyprotein?

Production of recombinant CfMV replicase polyprotein for research typically follows these methodological steps:

  • Expression system selection: E. coli is the preferred expression system due to its simplicity, cost-effectiveness, and high yield potential . The full-length gene encoding the replicase polyprotein fragment (amino acids 398-942) is cloned into an appropriate expression vector with an N-terminal His tag.

  • Protein expression: Transformed E. coli cells are grown under optimized conditions and induced to express the recombinant protein. The protein is typically expressed as a fusion protein with an N-terminal His tag to facilitate subsequent purification .

  • Cell lysis: Bacterial cells are harvested and lysed to release the recombinant protein. Lysis buffers typically contain protease inhibitors to prevent degradation of the target protein.

  • Affinity purification: The His-tagged protein is purified using immobilized metal affinity chromatography (IMAC), typically using Ni-NTA resin that binds specifically to the His tag.

  • Final processing: The purified protein is typically:

    • Subjected to buffer exchange to remove imidazole

    • Concentrated to the desired concentration

    • Lyophilized for long-term storage

For storage and handling, the following conditions are recommended:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

How can researchers verify the functionality of recombinant CfMV replicase polyprotein?

Verification of recombinant CfMV replicase polyprotein functionality can be performed through several complementary approaches:

  • SDS-PAGE analysis: Purity assessment using SDS-PAGE, with expected molecular mass of approximately 60 kDa for the ORF2a product alone or ~100 kDa for the full-length polyprotein containing both ORF2a and ORF2b products .

  • Western blot analysis: Using antibodies specific to different domains:

    • Anti-P2a antibodies can recognize the ORF2a-encoded portion

    • Anti-VPg antibodies can detect the VPg domain

    • Anti-P2b antibodies can recognize the ORF2b-encoded replicase domain

  • RNA-dependent RNA polymerase (RdRP) activity assay: Testing the enzymatic activity of the replicase by:

    • Providing template RNA

    • Measuring incorporation of labeled nucleotides

    • Analyzing the synthesis of complementary RNA strands

  • Proteolytic processing assessment: Examining the autocatalytic processing of the polyprotein by incubating the purified protein under appropriate conditions and analyzing the cleavage products by SDS-PAGE and Western blotting .

Western blot analysis of infected plant material has revealed that the polyprotein is processed at several sites, with antisera against ORF2a recognizing six distinct proteins, while VPg antiserum primarily recognizes a 24 kDa protein . This suggests that the processing pattern observed in vitro may differ from that in infected plants.

How do mutations in the stem-loop structure affect -1 PRF efficiency and virus infectivity?

The stem-loop structure downstream of the slippery sequence is critical for efficient -1 PRF in CfMV. Research has revealed specific relationships between stem-loop mutations, frameshifting efficiency, and viral infectivity:

  • Effect on frameshifting efficiency in vitro:

    • Mutations shortening or destabilizing the stem region significantly reduced but did not completely abolish -1 PRF in wheat germ extract (WGE)

    • Extending the loop region to seven nucleotides had no significant effect on frameshifting efficiency in WGE

  • Impact on virus infectivity:

    • Mutations that shortened or destabilized the stem proved deleterious for virus infection in oat plants

    • Loop region extension to seven nucleotides did not hamper virus replication in infected leaves

These findings suggest that a threshold level of frameshifting efficiency is required for successful virus replication in plants. While some modifications may be tolerated in vitro with only partial reduction in frameshifting efficiency, the same mutations may completely prevent viral replication in planta.

Methodologically, researchers can study these effects by:

  • Creating specific mutations in the stem-loop structure using site-directed mutagenesis

  • Measuring frameshifting efficiency using dual reporter systems in vitro

  • Testing viral infectivity by inoculating plants with mutant viral RNA

  • Analyzing viral accumulation in infected plants through RT-PCR, Northern blotting, or immunodetection methods

This research highlights the importance of maintaining the proper secondary structure of the RNA frameshifting signal for viral fitness in natural hosts.

What is the role of the P27 protein in regulating CfMV replicase expression?

CfMV protein P27 may influence translation at the frameshift site, potentially serving as a regulatory mechanism for controlling the ratio between viral proteins. Experimental evidence for this regulatory function includes:

  • Co-expression studies: When P27 was co-expressed with dual reporter vectors containing the minimal -1 PRF signal in yeast, it reduced the production of the downstream reporter .

  • Specificity of the effect: Control experiments with non-translatable forms of P27 verified that P27 truly affected luciferase expression at the protein level .

  • Comparison with replicase effect: In contrast to P27, co-expression of CfMV replicase had no pronounced effect on translation at the frameshift site .

The precise mechanism by which P27 influences translation remains to be elucidated, but these findings suggest a potential feedback regulation where P27 may modulate the production of replicase during viral infection.

The experimental data from co-expression studies in yeast is summarized in the following table:

ConstructLacZ activityLuc/LacZ ratioNumber of experiments
-1 PRF constructs
A + Empty vector0.56 ± 0.098.58 ± 1.63n = 4
A + P270.50 ± 0.096.06 ± 1.01n = 4
A + Rep0.55 ± 0.1110.65 ± 1.92n = 4
Inframe controls
Am + Empty vector0.52 ± 0.1058.56 ± 9.4n = 4
Am + P270.50 ± 0.0926.99 ± 7.2n = 4
Am + Rep0.49 ± 0.1156.66 ± 8.3n = 4

Data shows enzymatic activities measured from yeast lysate samples where CfMV P27, CfMV replicase, or empty expression vector was co-expressed with dual reporter vectors

This potential regulatory mechanism could be critical for maintaining the optimal balance between viral proteins during different stages of infection.

How does the polyprotein processing of CfMV compare with other sobemoviruses?

The polyprotein processing of CfMV displays both similarities and distinct differences compared to other sobemoviruses:

  • VPg domain location and processing:

    • In CfMV, the VPg domain is located between the serine proteinase and replicase motifs

    • The N-terminus of CfMV VPg is cleaved from the polyprotein between glutamic acid and asparagine residues

    • The determined N-terminal sequence of CfMV VPg (VTVE-NSELYPDQSS) differs completely from that of SBMV (RSQE-TLPPELSVIE)

  • Processing patterns:

    • Western blot analysis of infected plant material shows that the CfMV polyprotein is processed at several sites, with antisera against ORF2a recognizing six distinct proteins

    • The VPg antiserum primarily recognizes a 24 kDa protein in infected plants, suggesting that the fully processed 12 kDa VPg is a minor product

    • The replicase appears to be entirely or almost entirely encoded by ORF2b, as indicated by recognition of a 58 kDa protein by antiserum against the ORF2b product

  • Proposed processing model:

    • Based on the N-terminal sequence of VPg, the CfMV polyprotein is cleaved between glutamic acid (E) and asparagine (N)

    • An additional site resembling this determined cleavage site was found elsewhere in the polyprotein

    • The C-terminus of mature VPg may originate from either frame, and its estimated location crosses both ORFs 2a and 2b

What methods are most effective for studying CfMV replicase interactions with host factors?

Understanding CfMV replicase interactions with host factors requires a multi-faceted experimental approach:

  • Yeast two-hybrid (Y2H) screening:

    • Express the replicase or specific domains as bait proteins

    • Screen against plant cDNA libraries to identify interacting host proteins

    • Verify interactions through co-immunoprecipitation or pull-down assays

  • Co-immunoprecipitation (Co-IP) from infected plants:

    • Use antibodies against the viral replicase to immunoprecipitate the protein complex

    • Identify co-precipitated host proteins by mass spectrometry

    • Validate identified interactions through reverse Co-IP

  • Proximity-dependent biotin labeling:

    • Fuse the replicase to a biotin ligase (BioID or TurboID)

    • Express in plant cells and analyze biotinylated proteins

    • This approach captures both stable and transient interactions

  • Confocal microscopy and co-localization studies:

    • Express fluorescently tagged replicase in plant cells

    • Observe co-localization with cellular organelles or known host factors

    • Conduct FRET or BiFC assays to confirm direct interactions

  • Functional validation:

    • Silence identified host genes through VIGS or CRISPR

    • Assess effects on viral replication

    • Complement with exogenous expression of the host factor

Several studies of related sobemoviruses have demonstrated that viral replicases interact with host translation factors and components of the cellular RNA silencing machinery. These interactions can significantly impact viral replication efficiency and host defense responses.

What is the evolutionary history of CfMV replicase and its implications for sobemovirus biology?

Recent research on the evolutionary history of sobemoviruses, including CfMV, has revealed surprising insights about their ancient origins:

  • Deep evolutionary timeline:

    • Sobemoviruses have a deep evolutionary history stretching back millions of years

    • The split between CfMV and Rice yellow mottle virus (RYMV) occurred more than 500,000 years ago during the Pleistocene epoch

    • This timeline is much earlier than the Neolithic period, challenging assumptions about recent virus emergence

  • Substitution rate estimates:

    • Short-term substitution rate estimates for CfMV are largely similar to those of RYMV

    • These rate estimates were used to calibrate evolutionary models and reconstruct sobemovirus history using the Poissonian waiting time (PoW) model

  • Host range evolution:

    • CfMV and its close relative Cynosurus mottle virus (CnMoV) both originated in Europe and have overlapping host ranges

    • They infect temperate crops like wheat, oat, barley, and rye but not maize, sorghum, or rice

    • This contrasts with RYMV, which infects plants in the Oryza genus, and its sister species IYMV, which infects maize and other specific grasses

  • Genetic diversity patterns:

    • Pairwise genetic identity analysis in ORF2b (encoding replicase) across sobemovirus species revealed distinct patterns:

      • A major mode from 57-73% genetic identity

      • A minor mode from 77-84%

      • A "shoulder" from 91-100%

These evolutionary findings have significant implications:

  • They suggest that sobemoviruses have co-evolved with their hosts over much longer timeframes than previously thought

  • The narrow host range of individual viruses despite broader family-level host range indicates specialized adaptation

  • Understanding these evolutionary patterns may help predict potential host shifts and emergence of new viral variants

This research connects molecular mechanisms of replicase function to broader evolutionary patterns, providing context for interpreting virus-host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.