Recombinant Cocos nucifera 1-acyl-sn-glycerol-3-phosphate acyltransferase

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cocos nucifera 1-acyl-sn-glycerol-3-phosphate acyltransferase

Cocos nucifera 1-acyl-sn-glycerol-3-phosphate acyltransferase, also known as lysophosphatidic acid acyltransferase (LPAAT) or 1-AGP acyltransferase, is an enzyme found in the coconut palm (Cocos nucifera) . Specifically, it is found in immature coconut endosperm . This enzyme plays a crucial role in lipid biosynthesis .

The enzyme catalyzes the conversion of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) .
In other words, it facilitates the acylation of acyl-CoAs to the sn-1 position of the glycerol-3-phosphate (G3P) backbone .

Cloning and Expression

The cDNA encoding Cocos nucifera 1-acyl-sn-glycerol-3-phosphate acyltransferase has been cloned from coconut endosperm . The open reading frame encodes a protein of 308 amino acids with a calculated molecular mass of 34.8 kD . When expressed in Escherichia coli, the coconut cDNA confers a novel LPAAT activity with a substrate activity profile matching that of the coconut enzyme . A homologous gene was identified by BLAST searching an assembled coconut endosperm transcriptome . The sequences are approximately 78% identical .

Function and Substrate Specificity

This acyltransferase exhibits a preference for medium-chain-length fatty acyl-coenzyme A substrates . It accepts medium-chain-length substrates . Cocos nucifera GPAT9 may assist in boosting the MCFA content of transgenic oils .

Recombinant Protein

Recombinant full-length Cocos nucifera 1-acyl-sn-glycerol-3-phosphate acyltransferase protein, fused to an N-terminal His tag, can be expressed in E. coli .

Specifications of Recombinant Protein :

FeatureDescription
SpeciesCocos nucifera (Coconut palm)
SourceE. coli
TagHis
Protein LengthFull Length (1-308)
FormLyophilized powder
Amino Acid SequenceMDASGASSFLRGRCLESCFKASFGMSQPKDAAGQPSRRPADADDFVDDDRWITVILSVVRIAACFLSMMVTTIVWNMIMLILLPWPYARIRQGNLYGHVTGRMLMWILGNPITIEGSEFSNTRAIYICNHASLVDIFLIMWLIPKGTVTIAKKEIIWYPLFGQLYVLANHQRIDRSNPSAAIESIKEVARAVVKKNLSLIIFPEGTRSKTGRLLPFKKGFIHIALQTRLPIVPMVLTGTHLAWRKNSLRVRPAPITVKYFSPIKTDDWEEEKINHYVEMIHALYVDHLPESQKPLVSKGRDASGRSNS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Role in Triacylglycerol (TAG) Synthesis

Glycerol-3-phosphate acyltransferase 9 (GPAT9) expression affects triacylglycerol (TAG) content . Co-expression of Cocos nucifera lysophosphatidic acid acyltransferase (CnLPAAT) and Elaeis guineensis diacylglycerol acyltransferase (EgDGAT1) results in increased TAG content .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer request.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its incorporation.
Synonyms
1-acyl-sn-glycerol-3-phosphate acyltransferase; 1-AGP acyltransferase; 1-AGPAT; Lysophosphatidic acid acyltransferase; LPAAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Cocos nucifera (Coconut palm)
Target Protein Sequence
MDASGASSFLRGRCLESCFKASFGMSQPKDAAGQPSRRPADADDFVDDDRWITVILSVVR IAACFLSMMVTTIVWNMIMLILLPWPYARIRQGNLYGHVTGRMLMWILGNPITIEGSEFS NTRAIYICNHASLVDIFLIMWLIPKGTVTIAKKEIIWYPLFGQLYVLANHQRIDRSNPSA AIESIKEVARAVVKKNLSLIIFPEGTRSKTGRLLPFKKGFIHIALQTRLPIVPMVLTGTH LAWRKNSLRVRPAPITVKYFSPIKTDDWEEEKINHYVEMIHALYVDHLPESQKPLVSKGR DASGRSNS
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid by acylating the 2-position. It exhibits a preference for medium-chain-length fatty acyl-coenzyme A substrates.
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is coconut 1-acyl-sn-glycerol-3-phosphate acyltransferase and how was it first identified?

Coconut (Cocos nucifera) 1-acyl-sn-glycerol-3-phosphate acyltransferase (LPAAT) is an enzyme that catalyzes the acylation of lysophosphatidic acid to form phosphatidic acid, a critical step in the Kennedy pathway for glycerolipid biosynthesis. The enzyme demonstrates a distinctive preference for medium-chain-length fatty acyl-coenzyme A substrates, which contributes to the characteristic fatty acid profile of coconut oil.

The initial identification of this enzyme involved chromatographic separations of solubilized membrane preparations from immature coconut endosperm. Researchers identified a 29 kDa polypeptide whose presence in column fractions correlated with acyltransferase activity. Amino acid sequence data from peptides generated from this protein facilitated the isolation of a full-length clone from a coconut endosperm cDNA library. The resulting clone, designated pCGN5503, contained a 1325-bp cDNA insert with an open reading frame encoding a 308-amino acid protein with a calculated molecular mass of 34.8 kDa .

What is the molecular structure and functional organization of CnLPAAT?

CnLPAAT is characterized by an open reading frame encoding a 308-amino acid protein with a calculated molecular mass of 34.8 kDa. Sequence analysis reveals significant homology to other putative LPAAT sequences in databases, confirming its classification within this enzyme family .

When expressed in Escherichia coli, the recombinant enzyme confers a novel LPAAT activity with a substrate activity profile that matches that of the native coconut enzyme. This confirms that the cloned gene encodes a functional LPAAT enzyme capable of utilizing medium-chain-length acyl-CoA substrates .

The functional organization includes membrane-spanning domains typical of membrane-associated acyltransferases, with conserved regions involved in substrate binding and catalysis. The enzyme's preference for medium-chain acyl-CoA substrates distinguishes it from many other plant LPAATs that typically prefer long-chain acyl-CoAs.

How does CnLPAAT compare to other plant acyltransferases in the glycerolipid synthesis pathway?

CnLPAAT shows distinctive substrate preferences compared to other plant acyltransferases. Its strong affinity for medium-chain acyl-CoA substrates is relatively uncommon among plant LPAATs, which typically prefer long-chain acyl-CoAs. This preference is likely an evolutionary adaptation related to the high medium-chain fatty acid content of coconut endosperm oil.

In the broader context of glycerolipid synthesis, CnLPAAT functions alongside other key enzymes like glycerol-3-phosphate acyltransferase (GPAT) and diacylglycerol acyltransferase (DGAT). Research has shown that when co-expressed with coconut GPAT9 (CnGPAT9) and palm (Elaeis guineensis) DGAT1 (EgDGAT1), there is enhanced production of triacylglycerols (TAGs) containing medium-chain fatty acids in heterologous expression systems .

The sequential assembly of the Kennedy pathway incorporating CnLPAAT results in both significantly increased total TAG content and a significantly increased accumulation of C12:0 in the TAG profile. This indicates that CnLPAAT plays a crucial role in directing medium-chain fatty acids into storage lipids .

What are the optimal parameters for heterologous expression of functional recombinant CnLPAAT?

The optimal parameters for heterologous expression of functional recombinant CnLPAAT depend on the expression system and research objectives. Based on published methods, several key parameters have been identified:

Expression System Selection:

  • E. coli expression: Successful expression has been achieved in E. coli, yielding a functional enzyme with a substrate specificity profile matching the native coconut enzyme. This system is advantageous for rapid protein production and initial characterization .

  • Plant transient expression: For functional studies in a plant background, Nicotiana benthamiana transient expression systems using Agrobacterium-mediated infiltration have proven effective. This approach allows for co-expression with other pathway components and assessment of impacts on lipid metabolism in a plant cellular context .

Expression Conditions:

  • Temperature: Lower induction temperatures (16-25°C) often improve the folding of membrane proteins like CnLPAAT

  • Induction duration: For plant transient expression, a 5-day expression period has been used successfully for CnLPAAT along with other lipid biosynthetic genes

  • Promoter selection: Strong constitutive promoters for general expression or inducible promoters for controlled expression

Co-expression strategies:
The most effective expression of CnLPAAT for TAG modification occurs with coordinated expression of multiple pathway components. For maximum medium-chain fatty acid incorporation into TAG, the following combination has shown optimal results: thioesterase (UcTE from Umbellularia californica) + CnLPAAT + CnGPAT9 + EgDGAT1, achieving approximately 51.6±2.0% C12:0 incorporation with a total TAG content of 2.4±0.7% .

What methodological approaches are most effective for analyzing CnLPAAT activity and substrate specificity?

Several methodological approaches have proven effective for analyzing CnLPAAT activity and substrate specificity:

In vitro enzymatic assays:

  • Radiometric assays using 14C-labeled acyl-CoA substrates and lysophosphatidic acid

  • HPLC-based assays measuring product formation with various acyl-CoA substrates

  • Mass spectrometry to identify products and determine substrate preferences

In vivo functional analysis:

  • Heterologous expression in microbial systems (E. coli or yeast)

    • Analysis of cellular lipid profiles before and after expression

    • Complementation of LPAAT-deficient mutants

  • Plant transient expression systems:

    • Co-infiltration of N. benthamiana leaves with CnLPAAT and other pathway genes

    • Extraction and analysis of leaf lipids using the following methods:

      • Total lipid extraction procedures (e.g., modified Bligh and Dyer methods)

      • Thin-layer chromatography for lipid class separation

      • Gas chromatography-flame ionization detection (GC-FID) for fatty acid profile analysis

      • Liquid chromatography-mass spectrometry (LC-MS) for comprehensive lipid profiling

Data analysis approaches:

  • Quantification of TAG content (μg/mg dry weight)

  • Determination of fatty acid composition in TAG fractions (percentage of each fatty acid)

  • Analysis of specific TAG molecular species using LC-MS/MS

  • Comparative analysis with control samples (e.g., "No-TE" controls in N. benthamiana)

How can researchers optimize co-expression strategies for CnLPAAT with other enzymes in the Kennedy pathway?

Optimizing co-expression strategies for CnLPAAT with other enzymes in the Kennedy pathway requires careful consideration of gene combinations, expression levels, and metabolic context. Based on published research, the following approaches have proven effective:

Sequential pathway reconstruction:
Researchers have achieved optimal results by systematically rebuilding the Kennedy pathway through strategic gene combinations. The following stepwise approach has been successful:

  • Base expression: Start with a thioesterase (TE) to provide medium-chain fatty acid substrates

  • Add CnGPAT9: Incorporate the initial acyltransferase of the Kennedy pathway

  • Add CnLPAAT: Include the enzyme for the second acylation step

  • Add DGAT: Complete the pathway with a diacylglycerol acyltransferase (e.g., EgDGAT1)

Expression balancing:
Careful optimization of relative expression levels is crucial. Researchers can modify expression through:

  • Using promoters of different strengths

  • Employing different Agrobacterium strains or infiltration OD values

  • Adjusting the ratio of different Agrobacterium cultures in infiltration mixtures

Data from optimization experiments:
The following quantitative data demonstrates the impact of optimized co-expression strategies:

Gene CombinationTAG Content (μg/mg dry weight)C12:0 in TAG (%)
Control (p19 only)8.0 ± 2.4<1
UcTE + CnLPAAT8.4 ± 1.9~15
UcTE + CnLPAAT + AtDGAT113.0 ± 3.7~20
UcTE + CnLPAAT + AtWRI140.8 ± 8.0~25
UcTE + CnLPAAT + AtWRI1 + AtDGAT156.3 ± 3.2~30
UcTE + CnGPAT9 + CnLPAAT + EgDGAT1~24.051.6 ± 2.0

This data clearly demonstrates the synergistic effects of co-expressing CnLPAAT with complementary enzymes in the pathway .

What are the common challenges in expressing functional CnLPAAT in heterologous systems and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional CnLPAAT in heterologous systems:

Membrane protein expression issues:
As an integral membrane protein, CnLPAAT can be difficult to express in functional form. This may manifest as:

  • Protein aggregation and inclusion body formation

  • Misfolding and loss of activity

  • Toxicity to host cells

Solutions:

  • Use lower induction temperatures (16-22°C) to slow expression and improve folding

  • Include membrane-stabilizing additives in growth media

  • Try expression hosts specialized for membrane proteins (e.g., C41/C43 E. coli strains)

  • Use fusion tags that enhance solubility or membrane targeting

Substrate availability limitations:
Medium-chain acyl-CoAs may not be abundant in heterologous expression systems, limiting enzyme activity assessment.

Solutions:

  • Co-express with appropriate thioesterases (TEs) that produce medium-chain fatty acids

  • For optimal production of C12:0-containing TAGs, co-express with Umbellularia californica thioesterase (UcTE)

  • For C14:0-containing TAGs, co-express with Cinnamomum camphora thioesterase (CcTE)

  • For C16:0-containing TAGs, co-express with Cocos nucifera thioesterase FatB2 (CnTE2)

Metabolic bottlenecks:
Expression of CnLPAAT alone may not significantly alter lipid profiles due to limitations at other steps in the pathway.

Solutions:

Phenotypic consequences:
In plant expression systems, high levels of medium-chain fatty acids can cause leaf chlorosis and toxicity.

Solutions:

  • Co-express appropriate acyltransferases that efficiently incorporate MCFAs into TAG

  • The combination of UcTE + AtWRI1 + CnGPAT9 + CnLPAAT + EgDGAT1 has been shown to reduce chlorosis symptoms by efficiently sequestering potentially toxic medium-chain fatty acids into TAG

How can researchers confirm the specificity and activity of recombinant CnLPAAT?

Confirming the specificity and activity of recombinant CnLPAAT requires a multi-faceted approach combining molecular, biochemical, and analytical methods:

Molecular confirmation:

  • Sequence verification: Confirm that the cloned sequence matches the expected CnLPAAT sequence

  • Expression verification: Use Western blotting with appropriate antibodies or detection of fusion tags

  • Subcellular localization: Verify proper membrane localization using fluorescent protein fusions or subcellular fractionation

Functional assays:

  • In vitro enzyme assays:

    • Microsomal preparations from expressing cells

    • Purified reconstituted enzyme in liposomes

    • Substrate panel testing using various acyl-CoAs (C8:0 through C18:1)

    • Product analysis by TLC, HPLC, or mass spectrometry

  • Comparative activity profile:

    • Compare activity profile with native coconut LPAAT

    • The substrate activity profile of recombinant CnLPAAT should match that of the native coconut enzyme

Lipid profiling analyses:

  • TAG composition analysis:

    • Analyze TAG molecular species by LC-MS/MS

    • Quantify positional distribution of fatty acids using stereospecific analysis

    • Compare MCFA incorporation patterns with control expressions

  • Acyl chain composition analysis:
    When expressed in N. benthamiana with appropriate thioesterases and other acyltransferases, the following TAG acyl chain compositions have been observed:

    • Umbca-TE + CnLPAAT + AtWRI1: 29.6 ± 0.9% C12:0

    • Cinca-TE + CnLPAAT + AtWRI1: 38.2 ± 1.7% C14:0

    • Cocnu-TE2 + CnLPAAT + AtWRI1: 55.8 ± 2.6% C16:0

Complementation studies:
Express CnLPAAT in LPAAT-deficient mutants (bacterial or yeast) and evaluate restoration of growth or lipid synthesis phenotypes.

What analytical techniques provide the most comprehensive characterization of lipid modifications resulting from CnLPAAT expression?

Comprehensive characterization of lipid modifications resulting from CnLPAAT expression requires a combination of complementary analytical techniques:

Chromatography-based fatty acid analysis:

  • Gas Chromatography-Flame Ionization Detection (GC-FID):

    • Quantifies fatty acid methyl esters (FAMEs) derived from total lipids or specific lipid classes

    • Provides accurate quantification of fatty acid composition

    • Effective for monitoring changes in MCFA content (C8-C16)

  • Thin Layer Chromatography (TLC):

    • Separates lipid classes (TAG, DAG, phospholipids)

    • Useful for initial screening and visualization

    • Can be coupled with GC for class-specific fatty acid analysis

Mass spectrometry-based approaches:

  • Liquid Chromatography-Mass Spectrometry (LC-MS):

    • Provides detailed molecular species information

    • Identifies specific TAG species with MCFA incorporation

    • Quantifies regioisomers and stereospecific incorporation patterns

    • Can detect novel TAG species resulting from CnLPAAT activity

  • Multiple Reaction Monitoring (MRM):

    • Targets specific TAG molecular species

    • Based on ammoniated precursor ion and neutral loss product ions

    • Highly sensitive for detecting low-abundance TAG species

  • Shotgun Lipidomics:

    • Direct infusion MS/MS for comprehensive lipid profiling

    • High-throughput analysis of lipidome changes

Analytical parameters and specifications:
For optimal LC-MS analysis of TAGs modified by CnLPAAT expression:

  • Column: Poroshell (50 mm × 2.1 mm, 2.7 μm)

  • Flow rate: 0.2 mL/min

  • Mobile phases:

    • A: 10 mM ammonium formate in H₂O:acetonitrile:isopropanol (5:45:50, v/v)

    • B: 10 mM ammonium formate in H₂O:acetonitrile:isopropanol (5:20:75, v/v)

  • TAG identification: Based on ammoniated precursor ion and product ion from neutral loss

Data representation and analysis:
Effective data representation includes:

  • TAG molecular species distribution charts

  • Acyl chain composition analysis (percentage of each acyl chain from total TAG)

  • Comparative analysis of lipid pools (TAG, DAG, PC) to track MCFA incorporation pathways

  • Quantification of specific TAG species containing MCFAs

Research has shown that expression of CnLPAAT significantly increases the accumulation of medium-chain fatty acids in TAG molecular species, with particularly dramatic effects when co-expressed with appropriate thioesterases and other Kennedy pathway enzymes .

What are the promising areas for structure-function studies of CnLPAAT to enhance medium-chain fatty acid incorporation?

Structure-function studies of CnLPAAT represent a promising frontier for enhancing medium-chain fatty acid incorporation into glycerolipids. Several key research directions include:

Structural domain analysis:
Identifying the specific domains and amino acid residues responsible for substrate specificity is crucial. Researchers should focus on:

  • Comparative sequence analysis with LPAATs having different substrate preferences

  • Site-directed mutagenesis of conserved motifs and unique residues

  • Creation of chimeric enzymes combining domains from different LPAATs

  • Crystallographic or cryo-EM structural studies to elucidate the three-dimensional organization

The ~78% sequence identity between CnGPAT9 and AtGPAT9 provides a starting point for identifying regions that may contribute to the distinctive substrate preferences of the coconut enzyme .

Substrate binding pocket engineering:
Targeted modifications of the substrate binding pocket could enhance affinity for medium-chain acyl-CoAs or alter regiospecificity:

  • Rational design based on molecular modeling

  • Directed evolution approaches using selection for enhanced MCFA incorporation

  • Focus on regions homologous to those identified in other acyltransferases as determining substrate chain-length specificity

  • Optimizing enzyme stability in heterologous systems

  • Reducing product inhibition

  • Enhancing membrane association and orientation

Metabolic context optimization:
Understanding how CnLPAAT interacts with other enzymes and metabolites in the cellular environment:

  • Identifying protein-protein interactions that enhance activity

  • Studying the impact of membrane lipid composition on enzyme function

  • Exploring metabolic channeling of substrates between pathway enzymes

How might genomic and transcriptomic approaches advance our understanding of CnLPAAT variants and their regulation?

Genomic and transcriptomic approaches offer powerful tools for understanding CnLPAAT variants and their regulation:

Genomic approaches:

  • Genome-wide identification of LPAAT family members:

    • Complete sequencing and annotation of the coconut genome

    • Comparative genomics with other palm species and plants producing MCFAs

    • Identification of all LPAAT paralogs and their chromosomal distribution

  • Allelic diversity analysis:

    • Sequencing LPAAT genes from diverse coconut germplasm

    • Association of allelic variants with oil composition traits

    • Identification of naturally occurring variants with enhanced MCFA specificity

  • Promoter analysis:

    • Characterization of regulatory regions controlling CnLPAAT expression

    • Identification of cis-regulatory elements involved in tissue-specific or developmental expression

    • Functional testing of promoter variants

Transcriptomic approaches:

  • Expression profiling:

    • RNA-seq analysis across developmental stages of coconut endosperm

    • Correlation of CnLPAAT expression with MCFA accumulation patterns

    • Identification of co-expressed genes that may function in coordinated metabolic networks

  • Alternative splicing analysis:

    • Identification of CnLPAAT splice variants

    • Functional characterization of protein isoforms

    • Tissue or developmental stage-specific splicing patterns

  • Transcriptional regulation studies:

    • Identification of transcription factors regulating CnLPAAT expression

    • Analysis of epigenetic modifications affecting gene expression

    • Investigation of small RNA-mediated regulation

Integration with functional genomics:
Combining genomic/transcriptomic data with functional studies:

  • CRISPR-based genome editing to confirm gene function

  • Rapid testing of variant effects using transient expression systems

  • Engineering of superior variants based on natural diversity

The FATB gene family from coconut (CnFatB1, CnFatB2, and CnFatB3) has already been cloned and characterized, providing a model for comprehensive analysis of other lipid biosynthetic gene families like LPAAT .

What synergistic enzyme combinations might further optimize medium-chain fatty acid incorporation into structured lipids?

Research on synergistic enzyme combinations to optimize medium-chain fatty acid incorporation into structured lipids represents a promising frontier. Several strategic approaches warrant exploration:

Optimal thioesterase-acyltransferase combinations:
Different thioesterases produce distinct MCFA profiles, which can be paired with appropriate acyltransferases:

  • For C12:0 (lauric acid) incorporation: UcTE (U. californica thioesterase) with CnLPAAT and CnGPAT9

  • For C14:0 (myristic acid) incorporation: CcTE (C. camphora thioesterase) with CnLPAAT and CnGPAT9

  • For C16:0 (palmitic acid) incorporation: CnTE2 (C. nucifera thioesterase) with CnLPAAT and CnGPAT9

Complete Kennedy pathway reconstruction:
The most successful approach involves reconstructing the entire Kennedy pathway with enzymes optimized for MCFA incorporation:

  • Initial acylation: CnGPAT9

  • Second acylation: CnLPAAT

  • Final acylation: EgDGAT1 (E. guineensis DGAT1)

This combination, along with appropriate thioesterases and AtWRI1, has achieved up to 51.6±2.0% C12:0 incorporation in TAG with a total TAG content of 2.4±0.7% .

  • Transcription factors: AtWRI1 significantly increases TAG production when co-expressed with acyltransferases

  • Factors affecting feedback inhibition: Proteins involved in oil body formation or TAG storage

  • Phospholipid:diacylglycerol acyltransferase (PDAT) for alternative TAG synthesis pathways

Novel enzyme combinations to explore:

  • Lysophosphatidylcholine acyltransferase (LPCAT):

    • May enhance MCFA incorporation through the acyl editing pathway

    • Could provide an alternative route for MCFA incorporation into TAG

  • Specialized DGATs:

    • Testing additional DGAT enzymes from MCFA-producing plants

    • Engineering DGATs for enhanced MCFA specificity

  • Phospholipid remodeling enzymes:

    • Phospholipases that may release MCFAs from membrane lipids

    • Acyltransferases involved in phospholipid remodeling

Quantitative impact of enzyme combinations:
Research has demonstrated significant differences in TAG accumulation and composition based on enzyme combinations:

Enzyme CombinationMajor TAG SpeciesMCFA Content in TAG
UcTE aloneLimited TAGMinimal C12:0
UcTE + CnLPAATIncreased TAG with C12:0Moderate C12:0
UcTE + CnLPAAT + AtWRI1TAG with C12:029.6 ± 0.9% C12:0
UcTE + CnGPAT9 + CnLPAAT + EgDGAT1High levels of TAG with C12:051.6 ± 2.0% C12:0

These combinations demonstrate the synergistic effects possible through strategic pathway engineering .

How should researchers design control experiments when studying recombinant CnLPAAT activity?

Designing appropriate control experiments is critical for robust analysis of recombinant CnLPAAT activity. Researchers should implement the following control strategy:

Negative controls:

  • Empty vector controls:

    • Expression systems containing the same vector backbone without the CnLPAAT gene

    • Essential for distinguishing background acyltransferase activity in the host system

    • In plant expression studies, infiltration with p19 silencing suppressor alone serves as a baseline control

  • Inactive enzyme controls:

    • Expression of site-directed mutants with mutations in catalytic residues

    • Helps distinguish enzymatic from non-enzymatic changes in lipid profiles

    • Controls for potential indirect effects of protein overexpression

  • Substrate availability controls:

    • When studying MCFA incorporation, include conditions without co-expressed thioesterases

    • Helps distinguish effects of CnLPAAT specificity from substrate availability effects

    • "No-TE" controls are essential when analyzing the impact of different thioesterases

Positive controls:

  • Known LPAAT enzymes:

    • Expression of well-characterized LPAATs from other organisms

    • Provides comparative basis for activity assessment

    • AtLPAAT or other plant LPAATs with different specificities

  • Native enzyme preparation:

    • When possible, compare with native CnLPAAT extracted from coconut endosperm

    • Validates that recombinant enzyme behaves similarly to the natural form

Pathway controls:

  • Partial pathway reconstructions:

    • Systematic omission of individual components from multi-gene expressions

    • Essential for determining the specific contribution of CnLPAAT

    • Examples from literature include:

      • UcTE alone vs. UcTE + CnLPAAT

      • UcTE + CnLPAAT vs. UcTE + CnLPAAT + CnGPAT9

      • Complete pathway with substitutions of individual enzymes

  • Alternative enzyme combinations:

    • Substitution of CnLPAAT with LPAATs from other species

    • Replacement of other pathway enzymes while maintaining CnLPAAT

    • Comparison of different thioesterases with the same downstream enzymes

Environmental variables control:

  • Standardize growth conditions, expression time, and sampling methods

  • Include internal standards for quantitative analyses

  • Perform biological and technical replicates (n=3 or n=4 has been used in published studies)

What are the key considerations for scaling up recombinant CnLPAAT production for biochemical studies?

Scaling up recombinant CnLPAAT production for biochemical studies requires careful attention to several key factors:

Expression system selection:
Different systems offer distinct advantages and limitations for large-scale production:

  • Bacterial systems (E. coli):

    • Advantages: Rapid growth, high protein yields, ease of genetic manipulation

    • Limitations: Potential for inclusion bodies, lack of post-translational modifications

    • Optimization strategies:

      • Use specialized strains (C41/C43) designed for membrane protein expression

      • Consider fusion tags that enhance solubility (MBP, SUMO)

      • Optimize growth temperature and induction conditions

  • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae):

    • Advantages: Eukaryotic processing, higher likelihood of proper folding

    • Limitations: Longer growth times, different membrane composition

    • Optimization strategies:

      • Select appropriate promoters (AOX1, GAL1)

      • Optimize induction protocols

      • Consider multi-copy integrants for higher expression

  • Plant-based systems:

    • Advantages: Native-like lipid environment, post-translational modifications

    • Limitations: Lower yields, more complex extraction

    • Options:

      • Transient expression in N. benthamiana leaves

      • Stable transformation of model plants

      • Plant cell suspension cultures

Extraction and purification strategies:
As a membrane protein, CnLPAAT requires specialized approaches:

  • Membrane fraction preparation:

    • Gentle cell disruption methods to preserve activity

    • Differential centrifugation to isolate membrane fractions

    • Detergent screening to identify optimal solubilization conditions

  • Purification approaches:

    • Affinity chromatography using epitope tags (His, FLAG, etc.)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Activity preservation:

    • Inclusion of glycerol or other stabilizing agents

    • Careful selection of detergents that maintain activity

    • Consideration of reconstitution into liposomes for activity studies

Quality control metrics:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining

    • Western blotting for specific detection

    • Mass spectrometry for identity confirmation

  • Functional validation:

    • Activity assays with appropriate substrates

    • Circular dichroism for secondary structure analysis

    • Thermal stability assays

  • Yield quantification:

    • Protein concentration determination methods appropriate for detergent-solubilized proteins

    • Activity-based quantification

Scale-up considerations:

  • Bioreactor conditions for microbial expression systems

  • Optimization of induction timing and harvesting

  • Development of efficient downstream processing workflows

How can researchers effectively combine molecular biology and analytical chemistry approaches to comprehensively study CnLPAAT function?

A comprehensive study of CnLPAAT function requires the strategic integration of molecular biology and analytical chemistry approaches:

Molecular biology strategies:

  • Gene manipulation and expression:

    • Site-directed mutagenesis to probe structure-function relationships

    • Domain swapping with other LPAATs to identify specificity determinants

    • Expression with epitope or fluorescent protein tags for localization studies

    • Creation of variant libraries for directed evolution approaches

  • Multi-gene expression systems:

    • Coordinated expression of complete biosynthetic pathways

    • Use of multi-cistronic constructs or matching promoters

    • Development of inducible expression systems for temporal control

  • Genetic background manipulation:

    • Expression in wild-type and mutant backgrounds

    • CRISPR-mediated knockout of competing pathways

    • RNAi suppression of endogenous activities

Analytical chemistry approaches:

  • Enzyme activity assays:

    • In vitro assays with purified enzyme or microsomal preparations

    • Substrate competition assays to determine preferences

    • Kinetic analyses with various acyl-CoA substrates

  • Advanced lipid profiling:

    • Comprehensive lipidomics using high-resolution LC-MS/MS

    • Stereospecific analysis of TAG position-specific incorporation patterns

    • Stable isotope labeling to track metabolic flux

  • Structural biology methods:

    • X-ray crystallography or cryo-EM for structural determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Computational modeling and docking studies

Integration strategies:

  • Correlation of structural features with activity patterns:

    • Systematic mutation of specific residues

    • Immediate activity testing with defined substrates

    • Correlation of mutations with changes in lipid profiles

  • Temporal analysis of pathway operation:

    • Time-course sampling after induction

    • Tracking of intermediates and end products

    • Correlation with protein expression levels

  • Feedback loop between analytical results and design:

    • Use analytical results to guide next-generation construct design

    • Iterative optimization based on comprehensive lipid analysis

Example of integrated workflow:

  • Construct design and expression:

    • Design CnLPAAT variants based on sequence comparisons and structural predictions

    • Express in appropriate system alongside pathway partners

  • Functional screening:

    • Rapid assessment of TAG production using fluorescent dyes (Nile Red)

    • GC-FID analysis of fatty acid compositions

  • Detailed characterization:

    • LC-MS/MS analysis of TAG molecular species

    • Positional distribution analysis

    • In vitro enzyme assays with various substrates

  • Structure-function correlation:

    • Map activity differences to structural features

    • Design next-generation variants

  • Pathway optimization:

    • Adjust relative expression levels

    • Modify pathway components based on bottleneck identification

This integrated approach has yielded significant insights into CnLPAAT function, revealing its critical role in medium-chain fatty acid incorporation into TAG and its synergistic interactions with other Kennedy pathway enzymes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.