Recombinant Coffea arabica ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Coffea arabica ATP Synthase Subunit b, Chloroplastic (atpF)

Recombinant Coffea arabica ATP synthase subunit b, chloroplastic (atpF) is a protein component of the ATP synthase complex found in the chloroplasts of Coffea arabica (Arabian coffee) . ATP synthase, also known as F1F0-ATPase, is an enzyme complex that produces ATP (adenosine triphosphate) from ADP (adenosine diphosphate) using a proton or sodium gradient . In plants, this process occurs in chloroplasts during photosynthesis. The atpF subunit is a part of the F0 domain, which contains the membrane proton channel .

Function and Role of ATP Synthase Subunit b (atpF)

The ATP synthase complex consists of two main structural domains: F1 and F0 . The F1 domain contains the catalytic core and extends into the stroma, while the F0 domain is embedded in the thylakoid membrane and facilitates proton translocation . The atpF subunit is crucial for the rotary mechanism that couples proton transport to ATP synthesis .

Isolation and Expression

Recombinant atpF is produced using recombinant DNA technology, where the gene encoding the atpF subunit from Coffea arabica is expressed in a host organism such as E. coli . The expressed protein is then isolated and purified.

Applications and Research

The recombinant atpF subunit is used in various research applications:

  • ELISA assays: Recombinant atpF can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify antibodies against ATP synthase .

  • Structural studies: It can be used to study the structure and function of the ATP synthase complex .

  • Functional studies: Recombinant atpF is valuable for investigating the role of the atpF subunit in ATP synthesis and proton transport .

Related Research

Research on coffee plants has also explored genes expressed during infection by rust fungi and the impact of bioactive compounds from coffee by-products on human metabolism . These compounds can modulate lipid and glucose metabolism by activating specific signaling pathways .

Data Table: Properties of Recombinant Coffea arabica ATP Synthase Subunit b, Chloroplastic (atpF)

PropertyDescription
Gene NameatpF
SourceCoffea arabica (Arabian coffee)
Expression HostE. coli
Purity>85% (SDS-PAGE)
Storage (Liquid)6 months at -20°C/-80°C
Storage (Lyophilized)12 months at -20°C/-80°C
SequenceMKINPTTSGS GVSTLEKKNM GRIVQIIGPV LDVAFPAGKM PNIYNALVVK GRDTVGQPIN VTCEVQQLLG NNRVRAVAMS STDGLTRGME VIDTGAPLSV PVGGATLGRI FNVLGEPVDN LGAVDTRTTS PIHRSAPAFI QLDTKLSIFE TGIKVVDLLA PYRRGGKIGL FGGAGVGKTV LIMELINNIA KAHGGVSVFG

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Coffea arabica (Arabian coffee)
Target Names
atpF
Target Protein Sequence
MKNVTDSFLSLGHWPFAGSFGFFNTDILSTNLINLSVVLGVLIFFGKGVCASCLLSDLLD NRKQRILNTIRNSEELRGGAIEQLEKARTRLRKVEMEADQFRVNGYSEIEREKLNLINSI YKTLEQLENYKNETIQFEQQRTINQVRQRVFQQALQGALGTLNSCLNNELHLRTISANIG ILGSIKEKTD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-embedded proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the atpF gene in Coffea arabica and where is it located in the chloroplast genome?

The atpF gene in Coffea arabica encodes the b subunit of ATP synthase, a crucial enzyme for energy production in chloroplasts. This gene is part of the 155,189 bp chloroplast genome of C. arabica, which contains 130 genes in total . The genome includes a pair of inverted repeats of 25,943 bp, and atpF is one of the 79 protein-coding genes found in this genome . Like many chloroplast genes in plants, atpF contains introns - it is among the 18 genes in the C. arabica chloroplast that contain introns . The complete chloroplast genome sequence of C. arabica was the first to be reported from the Rubiaceae family, providing essential information for understanding the organization and evolution of genes like atpF in this economically important crop .

What is the functional significance of ATP synthase subunit b in chloroplasts?

ATP synthase subunit b (atpF) plays a critical structural and functional role in the F0F1 ATP synthase complex in chloroplasts. This complex is essential for ATP production during photosynthesis, utilizing the proton gradient established across the thylakoid membrane during light reactions. The b subunit forms part of the peripheral stalk of ATP synthase, connecting the membrane-embedded F0 portion to the catalytic F1 portion. This structural role is crucial for maintaining the stability of the complex during rotational catalysis and preventing unwanted rotation of the entire complex rather than just the central rotor. The protein's function is highly conserved across plant species, making it an important target for studying energy conversion mechanisms in photosynthetic organisms.

What are the recommended protocols for isolating intact chloroplast DNA from C. arabica for cloning atpF?

Isolating high-quality chloroplast DNA from Coffea arabica requires careful consideration of the plant's biochemical characteristics, particularly its high content of phenolic compounds and polysaccharides. Below is a recommended protocol:

  • Tissue selection and preparation:

    • Use young, fresh leaves (preferably 2-3 weeks old)

    • Harvest early in the morning to avoid accumulation of starch

    • Flash-freeze in liquid nitrogen immediately after harvesting

  • Chloroplast isolation:

    • Grind tissue in isolation buffer (330 mM sorbitol, 30 mM HEPES, 2 mM EDTA, 1 mM MgCl2, pH 7.8) with 0.1% BSA and 0.1% β-mercaptoethanol

    • Filter through miracloth

    • Centrifuge at 1,000 × g for 5 min to pellet chloroplasts

    • Resuspend and purify on Percoll gradient

  • DNA extraction:

    • Lyse chloroplasts with CTAB buffer containing 2% PVP to remove phenolics

    • Extract DNA using phenol-chloroform method

    • Precipitate with isopropanol and wash with 70% ethanol

    • Purify DNA using silica-based columns to remove contaminants

This protocol minimizes contamination with nuclear DNA and yields intact chloroplast genomes suitable for subsequent PCR amplification of atpF. For C. arabica specifically, the addition of antioxidants like ascorbic acid to buffers helps prevent oxidation of phenolic compounds that can degrade DNA quality.

What expression systems are most effective for producing recombinant chloroplastic proteins from C. arabica?

Several expression systems have been evaluated for producing recombinant chloroplastic proteins, with varying advantages depending on research objectives:

Expression SystemAdvantagesLimitationsYield (approx.)Best For
E. coliRapid growth, simple manipulation, high yieldLack of post-translational modifications, inclusion body formation10-100 mg/LStructural studies, antibody production
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, moderate yieldDifferent codon usage, hyperglycosylation5-50 mg/LFunctional studies requiring folding
Plant-based systems (N. benthamiana)Native-like folding and modifications, lower endotoxinLower yield, longer production time10 μg/g fresh leaf Functional studies, complex proteins
Chloroplast transformationProper folding environment, high expressionTechnical complexity, species-specific optimizationVariableIn vivo functional studies

For C. arabica chloroplastic proteins specifically, tobacco-based transient expression systems have shown promise, as demonstrated with other recombinant proteins . Nicotiana benthamiana transiently transformed via Agrobacterium infiltration can produce functional chloroplastic proteins with proper folding and targeting. Recent advances in DNA replicon vector expression in N. benthamiana have improved yields and could be applied to atpF expression .

When working with membrane proteins like ATP synthase subunit b, detergent optimization during extraction and purification becomes crucial regardless of the expression system chosen.

How can researchers verify the proper folding and functionality of recombinantly expressed atpF?

Verifying proper folding and functionality of recombinant ATP synthase subunit b requires multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure composition

    • Limited proteolysis to examine domain organization and stability

    • Size exclusion chromatography to assess oligomerization state

  • Functional assays:

    • ATP hydrolysis assays measuring phosphate release (reverse activity)

    • Proton translocation assays using pH-sensitive fluorescent dyes

    • Reconstitution with other ATP synthase subunits to assess complex formation

  • Integration verification:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Blue native PAGE to analyze incorporation into the full complex

    • Electron microscopy to visualize complex formation

  • In silico validation:

    • Structural modeling compared to known ATP synthase structures

    • Molecular dynamics simulations to assess stability

These approaches provide complementary information about whether the recombinant protein adopts its native conformation and retains its ability to function as part of the ATP synthase complex. For membrane proteins like atpF, additional steps to verify proper membrane insertion, such as protease protection assays, should be included.

What strategies can optimize heterologous expression of C. arabica atpF when confronting codon bias issues?

Codon optimization strategies for heterologous expression of C. arabica atpF should be tailored to the expression host while preserving functional elements:

  • Host-specific codon adaptation:

    • Calculate the Codon Adaptation Index (CAI) for the native sequence in the target host

    • Adjust codons to match tRNA abundance in the expression host

    • Maintain a CAI of >0.8 for optimal expression

  • mRNA stability considerations:

    • Remove sequences forming stable secondary structures, particularly in the 5' region

    • Eliminate internal ribosome binding sites and premature termination signals

    • Optimize the 5' untranslated region to enhance translation initiation

  • Critical region preservation:

    • Maintain native codon usage in regions suspected to affect co-translational folding

    • Preserve sequence elements involved in regulatory functions

  • Experimental validation approach:

    • Test multiple optimization algorithms (e.g., GeneOptimizer, OPTIMIZER, JCat)

    • Generate 2-3 variant constructs with different optimization strategies

    • Empirically determine which strategy yields the highest functional protein expression

For plant chloroplastic proteins expressed in bacterial systems, harmonization rather than maximization of codon usage has shown better results for proper folding. This approach adjusts codons to match the relative usage pattern in the host rather than simply choosing the most abundant codons.

RNA interference technology targeting DCL2 and DCL4 genes in plant expression systems (creating ΔD2ΔD4 plants) has demonstrated significantly increased recombinant protein yields, as these modified plants accumulate larger amounts of transgene-derived mRNAs by repressing RNA silencing mechanisms . This approach could be especially valuable for difficult-to-express proteins like membrane-associated ATP synthase components.

What are the challenges in reconstituting functional ATP synthase complexes with recombinant components?

Reconstituting functional ATP synthase complexes from recombinant components presents several significant challenges:

  • Stoichiometric assembly:

    • The F0F1 ATP synthase consists of multiple subunits in defined stoichiometry

    • Correct ratios must be maintained during reconstitution (α3β3γδεab2c10-15)

    • Controlled co-expression systems or precise mixing of purified components is required

  • Membrane integration:

    • The F0 domain including subunit b requires proper membrane insertion

    • Reconstitution into liposomes with appropriate lipid composition is critical

    • Lipid composition affects both assembly and activity of the complex

  • Protein-protein interactions:

    • Multiple specific interfaces must form correctly between subunits

    • The b subunit must properly interact with the F1 sector and other F0 components

    • Detergent selection critically affects maintenance of these interactions

  • Experimental validation challenges:

    • ATP synthesis activity is difficult to measure in reconstituted systems

    • Establishing proton gradients in artificial systems requires specialized techniques

    • Multiple assays are needed to verify both structural assembly and functional activity

A systematic approach involving stepwise assembly of subcomplexes, starting with the more stable F1 portion, followed by integration with membrane components like subunit b, has proven most successful. Cryo-electron microscopy of the reconstituted complexes provides valuable structural validation of proper assembly.

How can site-directed mutagenesis of atpF advance our understanding of ATP synthase function?

Site-directed mutagenesis of the atpF gene offers powerful insights into structure-function relationships of ATP synthase:

Target RegionResidue TypesPotential MutationsExpected EffectsAnalytical Methods
Transmembrane domainsHydrophobic residuesConservative (L→I, V→I)Membrane association changesMembrane fractionation, activity assays
Dimerization interfacePolar/charged residuesCharge reversals (E→K, R→E)Dimer stability alterationsBlue native PAGE, size exclusion chromatography
F1 interaction sitesConserved residuesAlanine scanningCoupling efficiency changesATP synthesis/hydrolysis ratio measurement
Hinge regionsGlycine, proline residuesFlexibility modulation (G→P, P→A)Conformational changesElectron microscopy, hydrogen-deuterium exchange

Key experimental approaches should include:

  • Functional impact assessment:

    • Measure ATP synthesis rates under different conditions

    • Analyze proton transport efficiency

    • Determine thermal stability of mutant complexes

  • Structural characterization:

    • Use FRET to measure distance changes between subunits

    • Apply molecular dynamics simulations to predict conformational impacts

    • Perform cross-linking studies to identify altered interactions

  • In vivo verification:

    • Complement ATP synthase-deficient strains with mutant constructs

    • Measure growth rates under different energy sources

    • Analyze membrane potential in complemented strains

By systematically altering key residues in atpF and determining both structural and functional consequences, researchers can build a comprehensive model of how the b subunit contributes to ATP synthase function, particularly its role in energy coupling and rotational catalysis.

How might CRISPR-Cas9 technology be applied to study atpF function in chloroplast genomes?

CRISPR-Cas9 technology offers revolutionary approaches for studying chloroplast genes like atpF, though with specific technical considerations:

  • Chloroplast genome editing strategies:

    • Direct chloroplast transformation with plastid-targeted CRISPR-Cas9

    • Biolistic delivery of ribonucleoprotein complexes

    • Agrobacterium-mediated nuclear transformation with chloroplast-targeted Cas9

  • Technical adaptations required:

    • Modification of PAM recognition sequences for chloroplast genome compatibility

    • Development of chloroplast-specific promoters for guide RNA expression

    • Optimization of homology-directed repair templates for chloroplasts

  • Experimental applications for atpF:

    • Creating precise point mutations to study structure-function relationships

    • Introducing in-frame fluorescent protein fusions for localization studies

    • Generating conditional knockdowns using inducible promoters

  • Validation approaches:

    • PCR-RFLP analysis to confirm edits

    • RT-qPCR to measure transcript changes

    • Western blotting to assess protein levels

    • Functional assays to determine phenotypic effects

While CRISPR editing of the nuclear genome is well-established, chloroplast genome editing remains challenging due to the high copy number of plastid genomes and the need for homoplasmy (uniform modification of all copies). Recently developed approaches using transplastomic lines that express Cas9 from the plastid genome show promise for overcoming these limitations in important crop species like C. arabica.

What potential applications exist for recombinant ATP synthase components in synthetic biology?

Recombinant ATP synthase components, including atpF, have emerging applications in synthetic biology:

  • Bioenergetic modules for artificial cells:

    • Integration of functional ATP synthase into synthetic membranes

    • Creation of minimal energy-generating systems

    • Coupling with other membrane proteins for complete energetic circuits

  • Nanomotor applications:

    • Harnessing the rotary motion of ATP synthase for nanomechanical devices

    • Engineering modified F1 components with altered torque or speed properties

    • Developing ATP-powered molecular machines

  • Biosensors and diagnostic tools:

    • Using ATP synthase components as highly sensitive ATP detectors

    • Developing conformational change sensors based on b subunit dynamics

    • Creating proton gradient sensors for cellular studies

  • Biohybrid materials:

    • Integrating ATP synthase into artificial surfaces for energy harvesting

    • Creating self-assembling protein-based materials with F1F0 components

    • Developing ATP-regenerating systems for in vitro applications

The b subunit specifically offers interesting possibilities as a membrane anchor for hybrid protein assemblies, potentially allowing the attachment of various functional domains to membrane surfaces in defined orientations. Recent advances in plant-based expression systems that can produce up to 10 μg/g of functional recombinant proteins in fresh leaf tissue provide a promising platform for producing these components at scale .

How does the structure and function of atpF in C. arabica compare with other plants used for recombinant protein production?

The structure and function of atpF in Coffea arabica show both conservation and divergence when compared to common plant expression hosts:

FeatureC. arabicaN. benthamianaA. thalianaNotable Differences
Gene length~1.5 kb~1.4 kb~1.3 kbIntron sizes vary significantly
Intron structureContains introns Contains intronsContains intronsC. arabica has longer introns in some regions
Protein size~200 aa~200 aa~200 aaHighly conserved length
Transmembrane domains1 N-terminal1 N-terminal1 N-terminalConserved membrane topology
Conservation levelReference~85% identity~80% identityHigher divergence in stromal domain
Post-translational modificationsSpecies-specificSpecies-specificSpecies-specificVariation in phosphorylation sites
  • Assembly kinetics: Variations in interaction surfaces may alter the efficiency of complex formation

  • Thermal stability: Species-adapted to different environmental conditions show corresponding stability differences

  • Regulatory mechanisms: Species-specific post-translational modifications can affect activity regulation

These comparative insights are valuable when designing expression strategies, as they inform decisions about whether to use the native C. arabica sequence or codon-optimized versions based on the expression host. For N. benthamiana expression systems, which have shown success with other recombinant proteins at yields around 10 μg/g fresh weight , understanding these differences can help maximize functional expression of atpF.

What strategies can address poor solubility of recombinant atpF protein?

Poor solubility is a common challenge when expressing membrane proteins like ATP synthase subunit b. Researchers can implement these strategies:

  • Expression conditions optimization:

    • Reduce expression temperature (16-20°C) to slow protein synthesis

    • Use weaker promoters to prevent overwhelming folding machinery

    • Add specific chaperones (GroEL/ES, DnaK/J) as co-expression partners

  • Protein engineering approaches:

    • Generate truncated constructs of functional domains

    • Create fusion proteins with solubility-enhancing partners (MBP, SUMO, TrxA)

    • Introduce strategic mutations to increase hydrophilicity of exposed regions

  • Extraction and purification optimization:

    • Screen multiple detergents systematically (DDM, LDAO, Fos-choline)

    • Use combinatorial detergent mixtures for improved extraction

    • Implement amphipol exchange for increased stability

  • Refolding strategies:

    • Isolate inclusion bodies and optimize denaturation conditions

    • Test stepwise dialysis with decreasing denaturant concentrations

    • Employ on-column refolding techniques with detergent gradients

For plant chloroplastic membrane proteins specifically, using plant-based expression systems can improve folding outcomes. The transient expression in Nicotiana benthamiana has proven effective for other recombinant proteins, allowing proper targeting to cellular compartments and native-like folding . DCL2- and DCL4-repressed N. benthamiana plants have shown improved recombinant protein accumulation and could be particularly valuable for challenging membrane proteins .

How can researchers accurately quantify ATP synthase activity when working with recombinant components?

Accurate quantification of ATP synthase activity with recombinant components requires multifaceted approaches:

  • ATP synthesis measurement:

    • Luciferase-based ATP detection (sensitivity: ~10 pmol)

    • NADP+ reduction coupled assay system

    • 32P-labeled ADP incorporation assay

  • ATP hydrolysis assessment:

    • Malachite green phosphate detection (sensitivity: ~5 nmol Pi)

    • Enzyme-coupled assays (pyruvate kinase/lactate dehydrogenase)

    • pH-sensitive indicators for proton release

  • Proton pumping validation:

    • Fluorescent pH indicators (ACMA, pyranine)

    • Potentiometric probes (oxonol VI)

    • Proteoliposome-based H+ flux measurements

  • Data analysis considerations:

    • Account for background ATPase activity

    • Determine specific activity (μmol ATP/min/mg protein)

    • Compare to native enzyme preparations as benchmarks

Assay TypeSensitivityAdvantagesLimitationsBest For
Luciferase ATP detection10-100 nMReal-time, high sensitivitySubstrate inhibitionLow activity samples
Malachite green Pi assay0.1-5 μMSimple, endpoint measurementInterference from buffersMultiple sample screening
ACMA fluorescence quenchingN/ADirect proton gradient detectionQualitative rather than quantitativeCoupling efficiency studies
Enzyme-coupled continuous assay1-10 μMReal-time kineticsMultiple components neededDetailed kinetic analysis

Standard curves must be generated for each assay under identical buffer conditions as the experimental samples to ensure accuracy. When working with recombinant subunits, activity reconstitution may be significantly lower than native complex activity, requiring high-sensitivity detection methods.

What are the best practices for analyzing gene expression of recombinant atpF in different host systems?

Accurate analysis of recombinant atpF expression requires tailored approaches depending on the host system:

  • RNA extraction optimization:

    • For plant tissues: Use protocols that address high polyphenol content and polysaccharides

    • For bacterial systems: Rapid extraction during log phase growth

    • For all systems: Include RNase inhibitors and perform DNase treatment

  • RT-qPCR best practices:

    • Select stable reference genes specific to each host system

    • For Coffea expression: Use genes like GAPDH, Actin, or UBQ10

    • Design primers spanning exon-exon junctions where possible

    • Perform comprehensive validation using the MIQE guidelines

  • Protein detection methods:

    • Develop specific antibodies against C. arabica atpF

    • Use epitope tags (His, FLAG, HA) for recombinant protein detection

    • Optimize Western blotting for membrane proteins using specific detergents

  • Integrated analysis approach:

    • Correlate transcript levels with protein abundance

    • Assess post-transcriptional regulation effects

    • Determine protein half-life using pulse-chase experiments

For plant systems, samples should be collected at consistent times of day to account for circadian regulation effects. RNA extraction protocols similar to those developed for Coffea cell suspensions can be applied, which include careful handling steps to ensure RNA integrity (as shown in Figure 3 of reference ). Expression analysis should include both absolute quantification (copies/cell) and relative expression compared to wild-type genes to fully understand expression dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.