Recombinant Coffea arabica Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Coffea arabica Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Coffea arabica Cytochrome b6-f complex subunit 4 (petD) is a protein expressed in E. coli, fused with an N-terminal His tag, and derived from Coffea arabica (Arabian coffee) . It is a full-length protein consisting of 160 amino acids . Cytochrome b6-f complex subunit 4 (petD) is a component of the cytochrome b6-f complex, essential for photosynthetic electron transport in plants and cyanobacteria .

Cytochrome b6-f Complex

The cytochrome $$b_6f $$ complex is a hetero-oligomeric membrane protein complex critical in the electron transport chain of oxygenic photosynthesis . It mediates electron transport between Photosystem II (PSII) and Photosystem I (PSI) . The complex facilitates plastoquinol-plastocyanin oxidoreductase activity, linear and PSI cyclic electron flow, proton translocation across the membrane, and photosynthetic redox control of energy distribution .

Subunit Composition and Function

In flowering plants, the cytochrome $$b_6f $$ complex comprises at least nine subunits and exists as a dimer . These subunits are encoded by both nuclear and plastid genes . The complex includes subunits such as PetA (cytochrome f), PetB (cytochrome $$b_6$$), and PetD (subunit IV) . PetD is homologous to the C-terminal half of the cytochrome b subunit found in $$bc_1$$ complexes .

The cytochrome $$b_6f $$ complex from M. laminosus consists of eight polypeptide subunits: PetA (cytochrome f), PetB (cytochrome $$b_6$$), PetC (Rieske ISP), and PetD (subunit IV) . These subunits bind or coordinate five tightly bound metallo-redox prosthetic groups, including hemes f, $$b_p$$, $$b_n$$, $$c_n$$, and the 2Fe-2S Rieske iron-sulfur protein (ISP) .

Recombinant PetD Protein Information

The recombinant full-length Coffea arabica Cytochrome b6-f complex subunit 4 (petD) protein is expressed in E. coli with an N-terminal His tag . Key specifications of the recombinant protein are detailed below.

ParameterDescription
SpeciesCoffea arabica (Arabian coffee)
SourceE. coli
TagHis
Protein LengthFull Length (1-160 aa)
FormLyophilized powder
AA SequenceMGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMVGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Gene NamepetD
SynonymspetD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
UniProt IDA0A366

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Coffea arabica (Arabian coffee)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MVGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.