Recombinant Coffea arabica Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional Studies

  • Electron Transport: The cytochrome b6f complex links PSII and PSI, enabling proton gradient formation for ATP synthesis. PetB mutations disrupt this process, leading to photosynthetic failure .

  • State Transitions: The C-terminal domain of PetB regulates phosphorylation of light-harvesting complexes (LHCII) in Chlamydomonas reinhardtii, optimizing light energy distribution .

  • Complex Assembly: Deletion of PetB’s stromal domain destabilizes the b6f complex, as shown in Arabidopsis thaliana mutants .

Production and Purification

Recombinant PetB is produced in E. coli with the following protocols:

ParameterSpecification
Storage BufferTris-based, 50% glycerol, pH 8.0
Purity>90% (SDS-PAGE)
Stability-20°C long-term; avoid freeze-thaw cycles

Comparative Analysis With Orthologs

Cytochrome b6 homologs across species exhibit functional conservation but sequence divergence:

SpeciesKey DifferencesReference
Prochlorothrix hollandicaLonger N-terminus (222 aa), distinct heme ci interaction
Oryza nivara85% sequence identity; used for chloroplast engineering studies
Arabidopsis thalianaPetB-PetM interaction stabilizes the b6f complex; loss causes leaf bleaching

Functional Insights From Mutational Studies

  • Heme ci Binding: Substitution of R207K in PetB slows STT7 kinase activation, impairing state transitions .

  • Subunit Interactions: PetB truncations in Chlamydomonas prevent b6f complex assembly, necessitating FTSH protease knockout for accumulation .

  • Evolutionary Stability: The petB gene is retained in coffee’s chloroplast genome, unlike infA, which was lost in some Rubiaceae species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Coffea arabica (Arabian coffee)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its role in Coffea arabica?

Cytochrome b6, encoded by the petB gene, is an essential component of the cytochrome b6/f complex located in the thylakoid membrane of chloroplasts in Coffea arabica. This protein plays a crucial role in the electron transport chain during photosynthesis, facilitating electron transfer between Photosystem II and Photosystem I. In C. arabica, the petB gene is encoded in the chloroplast genome, specifically within the large single-copy (LSC) region of the 155,189 bp chloroplast genome . Functionally, Cytochrome b6 contributes to the generation of a proton gradient across the thylakoid membrane that drives ATP synthesis, making it essential for energy production in coffee plants.

How is the petB gene organized in the Coffea arabica chloroplast genome?

The petB gene in Coffea arabica is located within the chloroplast genome as part of a gene cluster that includes other components of the cytochrome b6/f complex. The complete chloroplast genome of C. arabica is 155,189 bp in length and contains 130 genes, of which 112 are distinct and 18 are duplicated in the inverted repeat regions . The petB gene specifically belongs to the cytochrome b/f gene grouping that includes petA, petB, petD, and petG . Unlike some other chloroplast genes that have been transferred to the nuclear genome during evolution (such as infA in some Rubiaceae species), petB remains firmly established within the chloroplast genome of Coffea arabica, highlighting its importance in organellar function.

What are the recommended methods for working with recombinant Coffea arabica Cytochrome b6?

When working with recombinant Coffea arabica Cytochrome b6, researchers should employ techniques optimized for membrane proteins. After expression and purification, the protein should be stored in a Tris-based buffer containing 50% glycerol to maintain stability . For experimental use, Western blotting is a highly recommended technique for detection and analysis, with suggested antibody dilutions of 1:1000 to 1:5000 .

For functional studies, researchers should consider reconstitution into liposomes to maintain the native conformation of this membrane protein. When designing experiments, it is important to account for the hydrophobic nature of Cytochrome b6, which contains multiple transmembrane domains. Detergent selection is critical during purification, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) typically providing the best results for maintaining protein structure and function.

How should recombinant Cytochrome b6 be stored to maintain activity?

For optimal preservation of recombinant Coffea arabica Cytochrome b6 activity, the protein should be stored in a Tris-based buffer containing 50% glycerol . Long-term storage should be at -20°C, and for extended preservation, -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity .

When preparing aliquots for storage, researchers should:

  • Divide the purified protein into small working volumes to avoid repeated freeze-thaw cycles

  • Use sterile, low-protein binding microcentrifuge tubes

  • Flash-freeze aliquots in liquid nitrogen before transferring to -20°C or -80°C

  • Briefly centrifuge tubes before opening to collect any sample that may adhere to the cap or sides

  • Consider adding reducing agents like DTT or β-mercaptoethanol to prevent oxidation of critical cysteine residues

These storage conditions have been optimized to maintain the structural integrity and functional activity of the recombinant protein for experimental applications.

What detection methods are most effective for analyzing Cytochrome b6 in research applications?

Multiple detection methods can be employed for analyzing Cytochrome b6 in research applications, with immunodetection techniques being particularly effective. Western blotting using specific antibodies against the N-terminal region of the protein is highly recommended, with optimal dilutions ranging from 1:1000 to 1:5000 . The expected molecular weight of Cytochrome b6 is approximately 24 kDa when analyzed by SDS-PAGE .

For more sophisticated analyses, researchers can employ:

  • Blue native PAGE (BN-PAGE) for studying the intact cytochrome b6/f complex

  • Mass spectrometry for precise protein identification and post-translational modification analysis

  • Spectroscopic methods to assess heme incorporation and functional electron transfer capability

  • Circular dichroism to evaluate the secondary structure of the recombinant protein

  • Immunoprecipitation to study protein-protein interactions within the photosynthetic apparatus

These methods can be complementary, providing a comprehensive characterization of both the structural and functional aspects of recombinant Cytochrome b6 in various experimental contexts.

How can recombinant Cytochrome b6 be utilized in chloroplast transformation studies?

Recombinant Cytochrome b6 can serve as a valuable tool in chloroplast transformation studies of Coffea arabica, particularly for understanding the integration and expression of foreign genes in the plastid genome. Researchers developing chloroplast transformation vectors for coffee can use the petB gene and its flanking sequences as homologous recombination targets. This approach becomes particularly important since Coffea arabica is the first sequenced member of the Rubiaceae family, and its chloroplast genome provides essential information for plastid transformation vector design .

When utilizing recombinant Cytochrome b6 in such studies, researchers should:

  • Identify intergenic spacer (IGS) regions with high sequence identity for optimal homologous recombination

  • Consider species-specific vectors from appropriate IGS regions of the coffee chloroplast genome

  • Use recombinant Cytochrome b6 as a control protein to validate chloroplast-expressed transgenes

  • Employ antibodies against Cytochrome b6 to assess the integrity of the thylakoid membrane during transformation

  • Monitor photosynthetic efficiency to ensure that chloroplast transformation does not disrupt the electron transport chain

This approach could facilitate the development of chloroplast-transformed coffee plants with enhanced resistance to pests or modified metabolic properties, such as naturally decaffeinated coffee through compartmentalized expression of caffeine-degrading enzymes .

What comparative genomic insights can be gained by studying Cytochrome b6 across plant species?

Comparative analysis of Cytochrome b6 across plant species offers valuable insights into evolutionary relationships and functional conservation of photosynthetic machinery. The petB gene in Coffea arabica can be compared with those of other plant families to understand patterns of chloroplast genome evolution. Studies have shown that while there is significant variation in intergenic spacer regions and genome organization across plant families, genes encoding core photosynthetic proteins like Cytochrome b6 are highly conserved .

A comparison of repeat sequences in chloroplast genomes across crop plants demonstrates interesting patterns:

Crop plantNo. of direct repeatsNo. of inverted repeatsTotal number of repeats
Coffea arabica538
Citrus sinensis9619
Daucus carota13215
Gossypium hirsutum16625
Glycine max131739
Solanum lycopersicum9112
Solanum bulbocastanum10114
Vitis vinifera8112

These comparative data indicate that Coffea arabica has fewer repeats compared to other crop plants, suggesting potentially different evolutionary pressures on the chloroplast genome structure . Such insights contribute to our understanding of chloroplast genome evolution and can inform strategies for genetic engineering and crop improvement.

How does Cytochrome b6 interact with other components of the photosynthetic apparatus in Coffea arabica?

In Coffea arabica, Cytochrome b6 forms a critical component of the cytochrome b6/f complex, serving as a nexus between Photosystem II and Photosystem I in the photosynthetic electron transport chain. The interaction of Cytochrome b6 with other components can be studied using recombinant protein and specific antibodies.

The functional interactions of Cytochrome b6 include:

  • Electron transfer from plastoquinol to plastocyanin, requiring precise docking interactions

  • Coordination with the Rieske iron-sulfur protein (PetC) to facilitate electron transport

  • Association with Cytochrome f (PetA) within the cytochrome b6/f complex

  • Participation in cyclic electron flow involving Photosystem I

  • Contributing to proton translocation across the thylakoid membrane for ATP synthesis

Advanced research techniques to study these interactions include co-immunoprecipitation studies, cross-linking experiments, and functional reconstitution assays. Researchers can use antibodies specific to the N-terminal region of Cytochrome b6, such as those developed against the Arabidopsis thaliana ortholog, which have demonstrated cross-reactivity with Cytochrome b6 from multiple plant species including potentially Coffea arabica .

What are common challenges when working with recombinant Cytochrome b6 and how can they be addressed?

Researchers working with recombinant Coffea arabica Cytochrome b6 typically encounter several challenges related to the protein's membrane-bound nature and complex structure. Common issues include low expression levels, inclusion body formation, improper folding, and difficulties in maintaining activity during purification and storage.

To address these challenges, researchers should consider the following approaches:

  • Expression system optimization: Use specialized expression systems designed for membrane proteins, such as bacterial strains with modified membrane compositions or eukaryotic systems for complex proteins.

  • Solubilization strategies: Carefully select detergents for solubilization; mild non-ionic detergents like DDM or LMNG often provide better results than harsh detergents like SDS.

  • Purification protocol adjustment: Implement step-wise purification including affinity chromatography followed by size exclusion, maintaining detergent concentrations above the critical micelle concentration throughout.

  • Storage optimization: Maintain protein stability through the addition of glycerol (50%) and appropriate buffer conditions, and store in small aliquots to avoid repeated freeze-thaw cycles .

  • Functional validation: Employ spectroscopic methods to confirm proper heme incorporation and electron transfer capability before proceeding with experimental applications.

By anticipating these challenges and implementing the suggested solutions, researchers can significantly improve their success rates when working with this complex membrane protein.

How can researchers validate the structural integrity and functionality of recombinant Cytochrome b6?

Validating both the structural integrity and functionality of recombinant Coffea arabica Cytochrome b6 requires a multi-faceted approach. Given the protein's role in electron transport, confirmation of proper folding and cofactor incorporation is essential.

Researchers should implement the following validation methods:

  • Western blot analysis: Confirm the correct molecular weight (24 kDa) using antibodies specific to the N-terminal region of Cytochrome b6 . This provides initial confirmation of expression and approximate size.

  • Spectroscopic analysis: Measure absorbance spectra to confirm proper incorporation of heme groups, with characteristic peaks at approximately 430 nm (Soret band) and 560 nm (α-band) in the reduced state.

  • Circular dichroism: Assess the secondary structure to confirm proper folding, particularly the alpha-helical transmembrane domains characteristic of Cytochrome b6.

  • Blue native PAGE: Evaluate the ability of recombinant Cytochrome b6 to assemble into higher-order complexes, particularly when co-expressed with other cytochrome b6/f complex components .

  • Electron transfer assays: Measure the capacity to transfer electrons using artificial electron donors and acceptors in reconstituted systems, providing functional validation.

These complementary approaches provide a comprehensive validation strategy, ensuring that the recombinant protein maintains both structural and functional properties similar to the native protein.

What bioinformatic tools are most useful for analyzing the sequence and structure of Cytochrome b6?

Bioinformatic analysis of Coffea arabica Cytochrome b6 can provide valuable insights into its structure, function, and evolutionary relationships. A combination of sequence and structure-based tools should be employed for comprehensive analysis.

Recommended bioinformatic tools include:

  • Multiple Sequence Alignment (MSA) tools: Programs like Clustal Omega, MUSCLE, or T-Coffee can align the Coffea arabica Cytochrome b6 sequence with orthologs from other species to identify conserved residues, which often correspond to functionally important regions.

  • Transmembrane domain prediction: Tools such as TMHMM, Phobius, or TOPCONS can predict the transmembrane helices of Cytochrome b6, essential for understanding its membrane topology.

  • Phylogenetic analysis software: Programs like MEGA, RAxML, or MrBayes can construct evolutionary trees to place Coffea arabica Cytochrome b6 in evolutionary context relative to other plant species, particularly useful for comparing with the closely related Solanaceae family .

  • Homology modeling: In the absence of a crystal structure for Coffea arabica Cytochrome b6, tools like SWISS-MODEL, Phyre2, or I-TASSER can generate structural models based on homologous proteins with known structures.

  • Functional site prediction: Tools like ConSurf can identify functionally important residues based on evolutionary conservation, while software like COACH can predict ligand binding sites and protein-protein interaction surfaces.

These computational approaches complement experimental methods and can guide hypothesis generation for further structural and functional studies of Cytochrome b6 in Coffea arabica.

How might Cytochrome b6 be targeted for improving photosynthetic efficiency in Coffea arabica?

Targeting Cytochrome b6 could represent a novel approach for enhancing photosynthetic efficiency in Coffea arabica, potentially leading to improved crop performance under changing climate conditions. The cytochrome b6/f complex is often considered a bottleneck in the photosynthetic electron transport chain, making it a promising target for optimization.

Researchers interested in this direction should consider:

  • Site-directed mutagenesis of specific residues in recombinant Cytochrome b6 to modify electron transfer rates or redox potentials

  • Overexpression studies to determine if increased levels of Cytochrome b6 can enhance electron flux through the photosynthetic apparatus

  • Investigation of natural variants of petB in different coffee cultivars to identify superior alleles

  • Engineering the interaction between Cytochrome b6 and other components of the electron transport chain to optimize energy conversion

  • Developing chloroplast transformation protocols specifically targeting the petB gene and its regulatory elements

These approaches could potentially enhance coffee productivity while improving resource use efficiency, an increasingly important consideration in sustainable agriculture.

What role might Cytochrome b6 play in stress response mechanisms in coffee plants?

Cytochrome b6 may play a significant role in mediating stress responses in Coffea arabica, particularly those involving oxidative stress and energy metabolism adjustments. As a key component of the photosynthetic electron transport chain, alterations in Cytochrome b6 function could influence how coffee plants respond to environmental challenges.

Potential research areas investigating this relationship include:

Understanding these mechanisms could facilitate the development of more resilient coffee varieties capable of maintaining productivity under increasingly challenging environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.