Recombinant Coffea arabica NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is NAD(P)H-quinone oxidoreductase subunit 4L in Coffea arabica?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a small membrane protein component of the chloroplast NDH complex in Coffea arabica. The protein functions as part of the photosynthetic electron transport chain, specifically in the chloroplast NAD(P)H dehydrogenase complex. This 101-amino acid protein is encoded by the ndhE gene in the chloroplast genome . Functionally, it participates in electron transfer from NAD(P)H to plastoquinone, contributing to cyclic electron flow and photoprotection in photosynthesis. The protein's small size (approximately 11 kDa) and membrane-embedded nature make it particularly challenging but valuable for understanding chloroplast energy metabolism in coffee plants.

Where is this protein located within the plant cell?

The NAD(P)H-quinone oxidoreductase subunit 4L is specifically localized in the chloroplast, as indicated by its "chloroplastic" designation. Within the chloroplast, this protein is embedded in the thylakoid membrane as part of the NDH complex. The chloroplast localization is consistent with its role in photosynthetic electron transport and its encoding by the chloroplast genome of Coffea arabica . The protein contains transmembrane domains, as evident from its hydrophobic amino acid sequence (MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGDIFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN), which facilitates its integration into the thylakoid membrane system . This membrane localization is essential for its function in electron transport processes.

What is the gene structure of ndhE in the Coffea arabica chloroplast genome?

The ndhE gene in Coffea arabica is located in the chloroplast genome, which has been fully sequenced and is 155,189 bp in length . Unlike some chloroplast genes, ndhE does not contain introns and is a single-exon gene encoding the 101-amino acid protein. The gene is part of the 130 genes present in the Coffea arabica chloroplast genome, where 112 are distinct and 18 are duplicated in the inverted repeat regions . The positioning of ndhE within the chloroplast genome is conserved among flowering plants, reflecting its essential function. The gene's context within the chloroplast genome provides insights into its evolutionary history and regulatory mechanisms in coffee plants compared to other species.

What functional role does NAD(P)H-quinone oxidoreductase play in photosynthesis?

The NAD(P)H-quinone oxidoreductase complex, of which subunit 4L is a component, plays several critical roles in photosynthesis:

• Cyclic electron flow: It facilitates cyclic electron transport around Photosystem I, generating additional ATP without producing NADPH, thereby balancing the ATP/NADPH ratio needed for carbon fixation .

• Chlororespiration: The complex participates in chlororespiration, an alternative electron transport pathway that operates in the dark and under stress conditions.

• Photoprotection: By providing an alternative electron sink during high light conditions, it helps protect the photosynthetic apparatus from photodamage.

• Stress response: The complex contributes to plant adaptation to various environmental stresses, including drought, high light, and temperature extremes.

The ndhE subunit, although small, is essential for the assembly and stability of the whole NDH complex, making it important for all these functions in coffee plants.

What are the optimal conditions for expression of recombinant NAD(P)H-quinone oxidoreductase subunit 4L?

Recombinant expression of NAD(P)H-quinone oxidoreductase subunit 4L from Coffea arabica has been successfully achieved in E. coli expression systems with specific optimization parameters . The optimal conditions include:

• Expression system: BL21(DE3) E. coli strain with T7 promoter-based vectors appears most effective for controlled expression.

• Temperature modulation: Induction at lower temperatures (16-18°C) rather than standard 37°C reduces inclusion body formation for this membrane protein.

• Induction parameters: 0.1-0.5 mM IPTG for 12-16 hours provides better soluble protein yield than higher concentrations or shorter times.

• Media composition: Use of terrific broth supplemented with 1% glucose improves expression compared to standard LB medium.

• Fusion partners: N-terminal His-tag fusion facilitates purification while minimally affecting protein folding. The recombinant protein described in the literature includes an N-terminal His-tag .

• Codon optimization: Codon optimization for E. coli significantly increases yield, as the coffee chloroplast genome uses a different codon preference than E. coli.

These conditions help overcome the challenges associated with expressing small membrane proteins while maintaining their native structure as much as possible for functional studies.

How does the structure of NAD(P)H-quinone oxidoreductase subunit 4L from Coffea arabica compare with other plant species?

Comparative analysis of NAD(P)H-quinone oxidoreductase subunit 4L across plant species reveals interesting evolutionary patterns:

• Sequence conservation: The protein shows high sequence conservation in the transmembrane domains across plant species, with more variable N-terminal and C-terminal regions. The Coffea arabica sequence shares approximately 80-85% identity with other eudicots.

• Structural comparison with Solanaceae: While Coffea arabica (Rubiaceae) and Solanaceae are both in the euasterid I clade, their chloroplast genomes show several differences. Coffee has a portion of rps19 duplicated in the inverted repeat and an intact copy of infA, unlike some Solanaceae members .

• Phylogenetic positioning: Phylogenetic analyses based on chloroplast protein-coding genes firmly place Coffea (Rubiaceae, Gentianales) within the euasterid I clade, with specific structural features of the ndhE gene supporting this classification .

• Size variation: The 101-amino acid length of the Coffea arabica ndhE protein is consistent with other angiosperms, though subtle length variations exist across plant families.

These structural comparisons provide insights into the evolutionary conservation of this important photosynthetic component and the specific adaptations in coffee plants.

What experimental approaches can be used to study the function of this protein in vivo?

Several cutting-edge experimental approaches can be employed to study NAD(P)H-quinone oxidoreductase subunit 4L function in vivo:

• Chloroplast transformation: The available complete chloroplast genome sequence of Coffea arabica provides regulatory and intergenic spacer sequences for utilization in chloroplast genetic engineering . This enables targeted modification of ndhE to study its function.

• CRISPR-based approaches: While challenging for chloroplast genes, nuclear-encoded factors affecting ndhE expression can be modified using CRISPR/Cas9 to indirectly study ndhE function.

• In vivo imaging techniques:

  • Fluorescence lifetime imaging microscopy (FLIM) to measure NDH complex activity

  • Electron paramagnetic resonance (EPR) to detect electron transfer events

  • Chlorophyll fluorescence analysis to measure photosynthetic parameters affected by NDH function

• Proteomics approaches: TMT labeling proteomics has been successfully applied to coffee proteins . This approach can be used to study how ndhE expression changes under different conditions and how its modification affects the broader proteome.

• Transgenic complementation: Expression of modified versions of the protein in ndh-deficient mutants from model plants can assess functional conservation and specific amino acid contributions.

These approaches provide a comprehensive toolkit for understanding this protein's role in coffee plant photosynthesis and stress responses.

How does this protein integrate with chloroplast electron transport mechanisms?

The integration of NAD(P)H-quinone oxidoreductase subunit 4L into chloroplast electron transport involves several sophistical molecular interactions:

• NDH complex assembly: The ndhE protein forms a critical subcomplex with other NDH subunits (particularly ndhC, ndhD, and ndhF) that constitutes the membrane domain of the complete complex. This assembly is essential for electron tunneling through the complex.

• Electron flow pathway:

  • Electrons from stromal NAD(P)H enter the complex via ferredoxin-binding subunits

  • Transfer through iron-sulfur clusters in the complex

  • ndhE and associated membrane subunits facilitate electron transfer to plastoquinone

  • Reduced plastoquinone feeds into the cytochrome b6f complex or completes cyclic flow around PSI

• Interactions with other complexes: The NDH complex containing ndhE physically associates with Photosystem I under certain conditions, forming a supercomplex that enhances cyclic electron flow efficiency.

• Regulatory interactions: The activity of the complex containing ndhE is regulated by:

  • Thioredoxin-mediated redox control

  • Calcium-dependent phosphorylation

  • Physical interaction with peripheral regulatory proteins

This integration highlights how the small ndhE subunit contributes to the sophisticated electron transport mechanisms that optimize photosynthetic efficiency in coffee plants.

What implications do mutations in the ndhE gene have for coffee plant resilience?

Mutations in the ndhE gene can significantly impact coffee plant resilience through several mechanisms:

• Drought tolerance: Plants with compromised NDH complex function show reduced drought tolerance due to impaired cyclic electron flow, which is crucial for maintaining proper ATP/NADPH ratios under water limitation. For coffee cultivation, this has particular significance given increasing drought events in coffee-growing regions.

• High light sensitivity: The NDH complex participates in photoprotective mechanisms. ndhE mutations can reduce the plant's ability to dissipate excess excitation energy under high light conditions, leading to oxidative damage.

• Temperature stress response: The NDH complex functions in chlororespiration, which becomes more important under temperature extremes. ndhE mutations can compromise this alternative electron flow pathway.

• CO₂ assimilation: Under fluctuating light conditions common in coffee plantations (due to shade trees or cloud cover), mutations affecting ndhE function can reduce photosynthetic efficiency and carbon assimilation rates.

• Disease resistance connections: There are emerging connections between chloroplast electron transport efficiency and plant immune responses, suggesting ndhE mutations might indirectly affect disease resistance.

Understanding these implications is particularly relevant for coffee breeding programs aimed at developing more climate-resilient varieties adapted to changing environmental conditions.

How does the recombinant protein differ functionally from the native form?

The recombinant His-tagged version of NAD(P)H-quinone oxidoreductase subunit 4L exhibits several differences from its native counterpart:

• Solubility characteristics: The recombinant protein with His-tag shows altered solubility compared to the native membrane-embedded form, requiring specific buffer conditions for maintaining structure (Tris/PBS-based buffer, pH 8.0, with 6% trehalose) .

• Stability considerations:

  • The recombinant protein shows sensitivity to freeze-thaw cycles

  • Storage recommendations include maintaining working aliquots at 4°C for up to one week

  • Long-term storage requires glycerol addition (recommended 50%) and storage at -20°C/-80°C

• Functional assay differences: The recombinant protein typically requires reconstitution in artificial membrane systems or detergent micelles to assess electron transfer function, compared to the native protein's membrane environment.

• Potential conformational differences: The N-terminal His-tag can influence protein folding, potentially affecting interactions with other NDH complex subunits.

• Post-translational modifications: The recombinant protein expressed in E. coli lacks potential post-translational modifications present in the native chloroplast protein.

What are the challenges in crystallizing this protein for structural studies?

Crystallizing membrane proteins like NAD(P)H-quinone oxidoreductase subunit 4L presents several specific challenges:

• Membrane protein stability: The hydrophobic nature of this protein makes it inherently unstable outside its native membrane environment, requiring careful detergent selection to maintain structural integrity.

• Small size limitations: At just 101 amino acids, the protein is relatively small, making crystallization more difficult due to fewer crystal contacts to stabilize the lattice.

• Detergent considerations:

  • Specific detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are needed

  • Detergent micelle size must be optimized to not interfere with crystal contacts

  • Phase separation must be avoided during concentration

• Complex dependency: The ndhE protein may not fold properly in isolation from other NDH complex components, potentially requiring co-crystallization with partner subunits.

• Reconstitution approaches: Alternative approaches include:

  • Lipidic cubic phase crystallization

  • Reconstitution in nanodiscs or amphipols

  • Crystallization of fusion constructs with crystallization chaperones

• Alternative structural methods: Given these challenges, researchers often employ complementary approaches like cryo-electron microscopy or nuclear magnetic resonance for structural characterization.

These technical challenges explain why high-resolution structures of many small membrane proteins from plant chloroplasts remain elusive despite their functional importance.

What are the preferred methods for purification of recombinant NAD(P)H-quinone oxidoreductase?

Purification of recombinant NAD(P)H-quinone oxidoreductase subunit 4L requires specialized techniques to maintain protein integrity:

• Initial extraction strategy:

  • Cell lysis using gentle methods (osmotic shock or enzymatic lysis)

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using carefully selected detergents (typically DDM or LMNG)

• Affinity chromatography protocol:

  • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin for His-tagged protein

  • Equilibration buffer containing stabilizing agents (6% trehalose as used in available preparations)

  • Gradient elution with imidazole (typically 20-250 mM)

  • Critical inclusion of detergent in all buffers

• Secondary purification:

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography as a polishing step

• Quality assessment methods:

  • SDS-PAGE with silver staining (>90% purity recommended)

  • Western blotting with anti-His antibodies

  • Mass spectrometry for identity confirmation

• Storage considerations:

  • Concentration to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (50% recommended)

  • Flash freezing in liquid nitrogen for long-term storage

  • Avoidance of repeated freeze-thaw cycles

This methodological approach helps overcome the challenges associated with purifying this small membrane protein while maintaining its structural and functional integrity.

How can activity assays be designed for this protein?

Designing activity assays for NAD(P)H-quinone oxidoreductase subunit 4L requires creative approaches to assess its function within the electron transport chain:

• Reconstituted system assays:

  • Incorporation into liposomes with other NDH complex components

  • Measurement of NADH oxidation by spectrophotometric monitoring at 340 nm

  • Tracking plastoquinone reduction using artificial electron acceptors (dichlorophenolindophenol)

• Electron paramagnetic resonance (EPR) spectroscopy:

  • Detection of transient radical species during electron transfer

  • Identification of specific cofactors involved in the electron transport process

  • Characterization of the electron transfer kinetics

• Artificial electron donor/acceptor systems:

  • Use of ferredoxin or ferredoxin-like molecules as electron donors

  • Employing quinone analogs as electron acceptors

  • Monitoring redox state changes of these molecules spectroscopically

• Complementation assays:

  • Expression in NDH-complex deficient mutants (from model plants like Arabidopsis)

  • Measurement of photosynthetic parameters (e.g., chlorophyll fluorescence transients)

  • Quantification of ATP/NADPH ratios as a functional output

• Binding assays with partner proteins:

  • Surface plasmon resonance (SPR) to measure interactions with other NDH subunits

  • Isothermal titration calorimetry (ITC) for thermodynamic characterization

  • Pull-down assays to identify interacting partners

These methodologies provide a comprehensive approach to characterizing the activity of this challenging membrane protein in vitro and in vivo.

What approaches are most effective for studying protein-protein interactions involving this subunit?

Several sophisticated techniques can effectively capture the protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 4L:

• Cross-linking mass spectrometry (XL-MS):

  • Chemical cross-linking of intact chloroplasts or recombinant systems

  • Digestion and mass spectrometric analysis to identify cross-linked peptides

  • Computational modeling of interaction interfaces based on cross-linked residues

• Co-immunoprecipitation strategies:

  • Generation of specific antibodies against ndhE or use of anti-His antibodies for the recombinant protein

  • Gentle solubilization of thylakoid membranes with digitonin or mild detergents

  • Mass spectrometry identification of co-precipitated proteins

• Split-reporter systems:

  • Bimolecular fluorescence complementation (BiFC) in plant protoplasts

  • Split-luciferase assays for quantitative interaction assessment

  • Bacterial two-hybrid systems adapted for membrane proteins

• Native electrophoresis approaches:

  • Blue native PAGE of solubilized thylakoid membranes

  • Second-dimension SDS-PAGE for subunit identification

  • Antibody probing of native complexes

• In silico prediction and validation:

  • Molecular modeling of interactions based on homologous structures

  • Molecular dynamics simulations to evaluate stability of predicted interactions

  • Experimental validation of key interface residues identified in silico

These methodologies collectively provide a comprehensive picture of how ndhE interacts with other proteins in the chloroplast electron transport chain, enabling a deeper understanding of its functional role.

How can site-directed mutagenesis be used to study functional domains?

Site-directed mutagenesis provides powerful insights into the structure-function relationships of NAD(P)H-quinone oxidoreductase subunit 4L:

• Target selection strategy:

  • Conserved residues identified through multi-species alignment

  • Charged residues in transmembrane regions (potential critical for function)

  • Residues predicted to form interaction interfaces with other subunits

  • Post-translational modification sites

• Mutagenesis approach for chloroplast genes:

  • Direct chloroplast transformation using biolistic methods

  • Homologous recombination-based replacement of the wild-type gene

  • Selection using spectinomycin resistance markers

• Expression systems for mutant analysis:

  • Expression in E. coli for in vitro studies

  • Complementation of cyanobacterial ndh mutants

  • Chloroplast transformation in model plant systems

• Functional assessment of mutants:

  • Electron transport activity measurements

  • Complex assembly analysis by native PAGE

  • Photosynthetic performance under normal and stress conditions

  • Protein stability and turnover rate evaluation

• Mutational scanning approaches:

  • Alanine scanning of consecutive residues

  • Charge reversal mutations to disrupt electrostatic interactions

  • Conservative vs. non-conservative substitutions to distinguish structural from functional roles

This systematic mutagenesis approach helps map the functional domains of this small but important protein and identifies critical residues for electron transport, complex assembly, and regulation.

What considerations are important for isotope labeling of this protein for NMR studies?

Isotope labeling of NAD(P)H-quinone oxidoreductase subunit 4L for NMR studies requires several specialized considerations:

• Expression optimization for labeling:

  • Minimal media formulation with ¹⁵N-ammonium chloride and/or ¹³C-glucose as sole nitrogen and carbon sources

  • Expression at lower temperatures (16-18°C) to improve folding despite slower growth

  • Extended induction times (18-24 hours) to compensate for slower growth in minimal media

• Selective labeling strategies:

  • Amino acid-selective labeling for specific residue types (e.g., ¹⁵N-leucine) to reduce spectral complexity

  • Reverse labeling to "silence" abundant amino acids

  • SAIL (Stereo-Array Isotope Labeling) for improved resolution of methyl groups

• Sample preparation for membrane proteins:

  • Selection of detergent micelles compatible with NMR (typically DPC or LPPG)

  • Alternative membrane mimetics like bicelles or nanodiscs

  • Deuterated detergents to reduce background signals

• NMR experimental considerations:

  • TROSY-based pulse sequences for better signal resolution

  • Perdeuteration of non-exchangeable hydrogens to improve relaxation properties

  • Magic angle spinning solid-state NMR as an alternative approach

• Data analysis approaches:

  • Assignment strategies for membrane proteins with high signal overlap

  • Secondary structure determination from chemical shift analysis

  • Distance constraints from paramagnetic relaxation enhancement

These technical considerations address the significant challenges posed by membrane proteins for NMR analysis, providing pathways to structural and dynamic information that can complement crystallographic approaches.

Comparative Analysis of ndhE Sequence Conservation

This comparative analysis illustrates the evolutionary conservation of the ndhE protein across plant lineages, with highest similarity among closely related species within the euasterid I clade .

Storage and Handling Protocol for Recombinant Protein

These guidelines are essential for maintaining protein stability and activity during experimental procedures, as membrane proteins like ndhE are particularly sensitive to storage conditions .

Experimental Troubleshooting Guide for Recombinant ndhE Studies

This troubleshooting guide addresses common challenges encountered when working with this challenging membrane protein, providing practical solutions based on published protocols and best practices.

Predicted Post-Translational Modifications in ndhE

This prediction of post-translational modifications provides targets for researchers investigating regulatory mechanisms of the NDH complex in coffee plants under different physiological conditions.