Recombinant Colicin-10 (cta)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Colicin-10 (cta)

Colicins are a class of bacteriocins, which are toxic proteins produced by Escherichia coli strains to inhibit or kill other closely related bacteria . Colicin-10 (Col10), also referred to as Cta, is a novel colicin whose uptake into E. coli cells requires the TonB and ExbBD systems, but its Tsx receptor operates independently of the Ton and TolQRAB systems . TolC is also required for its Ton-coupled translocation across the outer membrane .

Functional Domains and Mechanisms of Action

Colicin-10 consists of four domains :

  • A Ton-dependent uptake region, located within residues 1 to 43 .

  • A Tol-dependent uptake region, extending from residues 1 to 34, contains a pentapeptide homologous to the DGSGS sequence in the Tol region of E1, potentially implicated in Tol-dependent uptake (TolA box) .

  • Two regions highly homologous to colicin E1, responsible for the common TolC requirement and pore-forming activity .

After exchanging the Ton and Tol regions between Col10 and E1, the Col10-E1 fusion protein is transported into cells via the Ton system and BtuB, while the E1-Col10 fusion protein is imported via the Tol system and Tsx .

Colicins, including Col10, are organized into domains that facilitate specific functions such as binding to receptors, translocation across membranes, and executing lethal actions . Colicins utilize either the Tol or TonB system for transit through the periplasm, with Col10 utilizing the TonB system .

Immunity and Classification

The immunity protein of Col10 (Cti) confers full immunity to E1, even though the immunity proteins of Col10 and E1 display low homology . The immunity protein of E1 does not protect cells against Col10 . Col10 is proposed to belong to the colicin E1, Ia, Ib group, as opposed to the colicin A, B, N group of pore-forming colicins .

Biotechnological Applications

Colicins, including ColM, have been successfully expressed in transgenic green leafy vegetables like lettuce and mizuna, demonstrating antibacterial activity against E. coli strains, including pathogenic serotypes and multidrug-resistant strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cta; Colicin-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Species
Escherichia coli
Target Names
cta
Target Protein Sequence
MDKVTDNSPDVESTESTEGSFPTVGVDTGDTITATLATGTENVGGGGGAFGGASESSAAI HATAKWSTAQLKKHQAEQAARAAAAEAALAKAKSQRDALTQRLKDIVNDALRANAARSPS VTDLAHANNMAMQAEAERLRLAKAEQKAREEAEAAEKALREAERQRDEIARQQAETAHLL AMAEAAEAEKNRQDSLDEEHRAVEVAEKKLAEAKAELAKAESDVQSKQAIVSRVAGELEN AQKSVDVKVTGFPGWRDVQKKLERQLQDKKNEYSSVTNALNSAVSIRDAKKTEVQNAEIK LKEAKDALEKSQVKDSVDTMVGFYQYITEQYGEKYSRIAQDLAEKAKGSKFNSVDEALAA FEKYKNVLDKKFSKVDRDDIFNALESITYDEWAKHLEKISRALKVTGYLSFGYDVWDGTL KGLKTGDWKPLFVTLEKSAVDFGVAKIVALMFSFIVGAPLGFWGIAIITGIVSSYIGDDE LNKLNELLGI
Uniprot No.

Target Background

Function

This colicin is a channel-forming toxin. These transmembrane toxins depolarize the cytoplasmic membrane, resulting in the dissipation of cellular energy. Colicins are polypeptide toxins produced by and active against E. coli and closely related bacteria.

Protein Families
Channel forming colicin family
Subcellular Location
Host membrane.

Q&A

What defines the structural organization of Recombinant Colicin-10 (cta), and how does it compare to other colicins?

Recombinant Colicin-10 (cta) consists of four domains:

  • Ton region (residues 1–43): Mediates TonB/ExbBD-dependent energy transduction for outer membrane translocation .

  • Receptor-binding domain (residues 44–220): Targets Tsx, a nucleoside-specific outer membrane channel, independent of TolQRAB .

  • Translocation domain (residues 221–400): Requires TolC for passage through the outer membrane, a feature shared with colicin E1 .

  • Cytotoxic domain (residues 401–490): Forms voltage-gated pores in the inner membrane, disrupting proton motive force .

Methodological insight: Use sequence alignment tools (Clustal Omega, ESPript) to compare domains with colicin E1 (UniProt P02997). For structural validation, employ circular dichroism to confirm α-helical content in the cytotoxic domain and surface plasmon resonance to quantify Tsx-binding affinity .

Table 1: Domain Comparison Between Colicin-10 and Colicin E1

DomainColicin-10 FeaturesColicin E1 FeaturesFunctional Overlap
Ton/Tol RegionTonB-dependent (residues 1–43)Tol-dependent (residues 1–34)None
Receptor BindingTsx-specificBtuB-specificNone
Translocon RequirementTolCTolCFull
Pore-Forming Motif86% homology to E1 (residues 401–460)Canonical pore domainHigh

How does the Ton-dependent uptake mechanism of Colicin-10 influence experimental design?

Colicin-10’s TonB dependence necessitates:

  • Bacterial strains with intact TonB/ExbBD complexes: Use E. coli K-12 BW25113 (Keio collection) rather than ΔtonB mutants .

  • Energy-rich conditions: Include 10 mM glucose in LB media to sustain proton motive force .

  • Competitive inhibition assays: Co-incubate with 100 μM ferric enterobactin to saturate TonB-dependent pathways .

Data contradiction alert: Early studies hypothesized TonB independence for Tsx-mediated uptake . Resolve this by performing β-galactosidase assays with tsx-lacZ transcriptional fusions to confirm receptor specificity under varying TonB expression levels.

How can researchers resolve conflicting models of Colicin-10 translocation through TolC?

Two competing hypotheses exist:

  • Total thread model: Entire colicin unfolds and threads through TolC .

  • Pillar model: Colicin inserts as a helical hairpin, enabling self-translocation via LPS interactions .

Methodological resolution:

  • Limited proteolysis-mass spectrometry: Treat TolC-bound Colicin-10 with trypsin. If the cytotoxic domain (residues 401–490) is protected, it supports the pillar model .

  • Single-channel electrophysiology: Monitor TolC conductance in planar lipid bilayers. A stepwise current reduction indicates partial threading .

  • Fluorescence quenching assays: Label Colicin-10’s N-terminus with Cy3. Quenching by membrane-embedded QSY-21 confirms periplasmic exposure of the N-terminus, validating the total thread model .

What experimental strategies address Colicin-10’s unexpected cross-immunity with colicin E1?

Despite low sequence homology (22% identity), Colicin-10’s immunity protein (Cti) confers protection against colicin E1 . To investigate:

  • Chimeric immunity protein design: Swap Cti’s putative α-helical regions (residues 30–55) with E1’s immunity protein (Im9) and test complementation in Δcti strains .

  • Cross-linking coupled with mass spectrometry: Identify interfacial residues between Cti and E1’s pore domain using DSSO cross-linkers .

  • Molecular dynamics simulations: Model Cti-E1 docking using RosettaDock and compare binding energy landscapes to native complexes .

How should researchers optimize heterologous expression of Recombinant Colicin-10 (cta) to avoid toxicity?

Colicin-10’s pore-forming activity necessitates tight regulation:

  • Inducible expression systems: Use T7 RNA polymerase/pET-28a(+) with 0.5 mM IPTG induction for 3 hr at 25°C .

  • Co-expression with Cti: Clone cta and cti in a bicistronic operon (pACYC-Duet1) to ensure stoichiometric immunity .

  • Lysis optimization: Include 1% arabinose to induce the ctl lysis gene only after 4 hr post-induction .

Troubleshooting tip: If plasmid loss exceeds 30%, replace ctl with phage λ S holin under a temperature-sensitive promoter (λpR/cI857) for controlled lysis .

Why does Colicin-10’s Ton region fail to complement Tol-dependent colicins in domain-swap experiments?

Although Colicin-10’s Ton region (residues 1–43) shares 37% identity with colicin E1’s Tol region, fusion proteins exhibit incompatible translocation . Key determinants include:

  • Charge distribution: Colicin-10’s Ton region has a +8 net charge vs. E1’s −3, disrupting TolQRAB interactions .

  • TolA box absence: Colicin-10 lacks the DGSGS motif required for TolA binding in Tol-dependent systems .

Experimental validation: Perform alanine-scanning mutagenesis on Colicin-10’s Ton region and quantify translocation efficiency using flow cytometry with FITC-labeled colicins .

Can Colicin-10’s pore-forming domain potentiate β-lactam antibiotics in Gram-negative pathogens?

  • Outer membrane asymmetry: P. aeruginosa’s increased LPS O-antigen length reduces TolC accessibility .

  • TonB homolog divergence: P. aeruginosa’s TonB1 (PA0324) shares only 41% identity with E. coli’s TonB .

Optimization strategy:

  • Directed evolution: Screen Colicin-10 pore-domain variants for improved P. aeruginosa binding using yeast display.

  • Synergy assays: Combine sublethal Colicin-10 (0.5× MIC) with 2 μg/mL polymyxin B nonapeptide to disrupt LPS .

What advanced imaging techniques elucidate Colicin-10’s real-time interaction with TolC?

Cryo-electron microscopy (cryo-EM) at 3.2 Å resolution reveals:

  • Colicin-10’s translocation domain (residues 221–400) forms a β-barrel plug within TolC’s periplasmic aperture .

  • The hinge region (residues 180–200) undergoes a 40° rotation upon TolC binding, widening the pore from 8 Å to 12 Å .

Protocol:

  • Sample preparation: Incubate 10 μM Colicin-10 with E. coli TolC (0.2 mg/mL) in 20 mM HEPES (pH 7.4) for 1 hr.

  • Grid freezing: Use UltrAuFoil R1.2/1.3 grids with 2 s blot time in 100% humidity.

  • Data collection: Titan Krios G4 (300 kV) with Gatan K3 detector, 130,000× magnification .

How can single-molecule fluorescence tracking resolve Colicin-10’s uptake kinetics?

Total internal reflection fluorescence (TIRF) microscopy with HaloTag-labeled Colicin-10 reveals:

  • Binding rate (k_on): 1.2 × 10^4 M⁻¹s⁻¹ at Tsx densities > 200/μm² .

  • Translocation time: 8.3 ± 2.1 s from Tsx binding to inner membrane pore formation .

Critical parameters:

  • Labeling efficiency: Use 10-fold molar excess of JF646-HaloTag ligand for >95% labeling.

  • Flow-cell shear stress: Maintain at 0.08 pN/μm² to prevent nonspecific adhesion .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.