Recombinant Colicin-5 (cfa)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cfa; Colicin-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Species
Escherichia coli
Target Names
cfa
Target Protein Sequence
MDKVTDNSPDVESTESTEGSFPTVGVDTGDTITATLATGTENVGGGGGAFGGASESSAAI HATAKWSTAQLKKHQAEQAARAAAAEAALAKAKSQRDALTQRLKDIVNDALRANAARSPS VTDLAHANNMAMQAEAERLRLAKAEQKAREEAEAAEKALREAERQRDEIARQQAETAHLL AMAEAAEAEKNRQDSLDEEHRAVEVAEKKLAEAKAELAKAESDVQSKQAIVSRVAGELEN AQKSVDVKVTGFPGWRDVQKKLERQLQDKKNEYSSVTNALNSAVSIRDAKKTDVQNAEIK LKEAKDALEKSQVKDSVDTMVGFYQYITEQYGEKYSRIAQDLAEKAKGSKFSSVDEALAA FEKYKNVLDKKISKVDRDAIFNALESVNYDELSKNLTKISKSLKITSRVSFLYDVGSDFK NAIETGNWRPLFVTLEKSAVDVGVAKIVALMFSFIVGVPLGFWGIAIVTGIVSSYIGDDE LNKLNELLGI
Uniprot No.

Target Background

Function
Recombinant Colicin-5 (cfa) is a channel-forming colicin. These transmembrane toxins depolarize the cytoplasmic membrane, resulting in cellular energy dissipation. Colicins are polypeptide toxins produced by and are active against *E. coli* and closely related bacteria.
Protein Families
Channel forming colicin family
Subcellular Location
Host membrane.

Q&A

What is Colicin-5 and how is it classified among bacteriocins?

Colicin-5 (Cfa) belongs to the subclass of pore-forming colicins, which includes colicins 10, E1, Ia, Ib, and K. Nucleotide sequence determination and analysis of the activity, immunity, and lysis genes have confirmed this classification . Colicin-5 is encoded by the cfa gene and produces a protein of 490 amino acid residues with a molecular weight of approximately 53,137 Da, though its electrophoretic mobility corresponds to approximately 57 kDa when analyzed by SDS-PAGE . Like other pore-forming colicins, Colicin-5 forms transmembrane channels in the cytoplasmic membrane of sensitive cells, leading to cell death through membrane permeabilization.

What is the genomic organization of the Colicin-5 operon?

The Colicin-5 operon consists of three essential genes: the activity gene (cfa), the immunity gene (cfi), and the lysis gene (cfl). The cfa gene encodes the 490-amino acid Colicin-5 protein (molecular weight 53,137 Da), the cfi gene encodes a 96-amino acid immunity protein (molecular weight 11,498 Da), and the cfl gene encodes a 43-amino acid lysis protein (molecular weight 4,556 Da) . This operon organization follows the typical arrangement found in other pore-forming colicins, with the activity gene preceding the immunity gene, followed by the lysis gene.

How can high-level expression of Recombinant Colicin-5 be achieved?

High-level expression of Recombinant Colicin-5 requires careful consideration of vector choice and expression conditions. An efficient system involves constructing an expression vector containing both the colicin activity gene (cfa) and its immunity gene (cfi) . Specifically, the pQE30-cfa-cfi vector has been demonstrated to produce high levels of His-tagged Colicin-5, yielding approximately 60-80 mg/L of purified protein . The inclusion of the immunity gene is crucial as it prevents the cytotoxic effects of Colicin-5 on the host cells during expression, enabling higher yields of the recombinant protein. Expression optimization typically involves induction with IPTG in E. coli strains harboring the constructed vector, followed by affinity purification using the His-tag.

What purification strategies yield the highest purity of Recombinant Colicin-5?

For maximum purity of Recombinant Colicin-5, a multi-step purification protocol is recommended. When using His-tagged Colicin-5 constructs, affinity chromatography with Ni-NTA columns provides an effective initial purification step . Standard protocols involve:

  • Cell lysis under native or denaturing conditions (native conditions preferred for maintaining activity)

  • Binding of His-tagged Colicin-5 to Ni-NTA resin

  • Washing with buffers containing low concentrations of imidazole to remove non-specifically bound proteins

  • Elution with higher concentrations of imidazole

Additional purification steps may include ion-exchange chromatography or size-exclusion chromatography to remove remaining impurities. The purified His-tagged Colicin-5 maintains its bactericidal activity, indicating that the tag does not interfere with protein function . Proper handling during purification is essential as Colicin-5 may aggregate or lose activity if exposed to harsh conditions.

Which specific regions of Colicin-5 determine its functional specificity?

The functional specificity of Colicin-5 is determined by distinct regions within its structure. Mutational analysis and DNA fragment exchange experiments between Colicin-5 and related colicins have identified critical regions:

  • Immunity Specificity Region: Residues 405 to 424 of Colicin-5 have been identified as the region that determines the specific reaction between Colicin-5 and its immunity protein . This region corresponds to the amphiphilic α-helix 6 found in similar colicins such as E1 and Ia.

  • Membrane-Insertion Domain: The C-terminal domain contains hydrophobic segments that facilitate insertion into the cytoplasmic membrane to form the lethal pore.

  • Reception and Translocation Domains: The N-terminal regions of Colicin-5 contain domains involved in receptor binding and translocation across the bacterial outer membrane. These domains show high homology (93.7% identity) with Colicin-10, explaining why both colicins require the same proteins for import into sensitive cells .

Comparison studies between Colicin-5 and Colicin-10 have been particularly informative, as these colicins share significant sequence identity but exhibit different immunity specificities. The exchange of DNA fragments between these colicins has confirmed that the C-terminal pore-forming domain contains the determinants for immunity specificity.

How does the immunity protein (Cfi) inactivate Colicin-5?

The immunity protein (Cfi) inactivates Colicin-5 through a specific interaction that occurs immediately prior to the formation of the transmembrane channel . Evidence indicates that this inactivation takes place at the inner side of the cytoplasmic membrane rather than in the periplasmic space. The Cfi protein has a predicted structure with three transmembrane helices, with the N-terminal end located in the cytoplasm and the C-terminal end in the periplasm .

The specific amino acid sequences that determine the interaction between Colicin-5 and its immunity protein have been identified. In Cfi, the regions responsible for the specific reaction with Colicin-5 are located in the cytoplasm and at the inner side of the cytoplasmic membrane . This localization suggests that the immunity protein does not prevent Colicin-5 from entering the cytoplasmic membrane but instead interferes with channel formation after the colicin has inserted into the membrane.

Hybrid protein studies using β-lactamase fusions have confirmed the membrane topology of Cfi and supported the model of immunity protein action at the cytoplasmic face of the membrane . When β-lactamase was fused to specific sites in Cfi, only certain constructs conferred both immunity to Colicin-5 and ampicillin resistance, providing evidence for the proposed membrane orientation.

What are the most effective methods for assessing Colicin-5 bactericidal activity?

Effective assessment of Colicin-5 bactericidal activity requires standardized and sensitive methods. Based on research protocols, the following approaches are recommended:

  • Spot Test Assay: Apply serial dilutions of purified Colicin-5 onto a lawn of sensitive bacteria and observe zones of growth inhibition. This qualitative method provides a visual indication of activity.

  • Minimum Inhibitory Concentration (MIC) Determination: Determine the lowest concentration of Colicin-5 that inhibits visible growth of sensitive E. coli cells. Research has shown that His-tagged Colicin-5 is highly toxic to sensitive E. coli cells at concentrations as low as 0.01 μg/ml .

  • Membrane Permeabilization Assay: Measure the ability of Colicin-5 to permeabilize bacterial membranes using fluorescent dyes that enter cells only when membrane integrity is compromised.

  • Kill Curve Analysis: Expose sensitive bacteria to different concentrations of Colicin-5 and determine the rate of killing by sampling at various time points and plating for viable counts.

When conducting these assays, it is essential to include appropriate controls:

  • Positive control: Known active colicin preparation

  • Negative control: Buffer without colicin

  • Specificity control: Testing activity against immune cells (expressing Cfi) versus non-immune cells

How can researchers distinguish between Colicin-5 receptor binding and pore formation in experimental setups?

Distinguishing between receptor binding and pore formation requires specific experimental approaches:

  • Low-Temperature Binding Assay: At 4°C, Colicin-5 can bind to receptors but cannot form pores due to restricted membrane fluidity. Washing cells after low-temperature exposure and then shifting to 37°C allows researchers to separate binding from pore formation events.

  • Domain-Specific Mutations: Generate Colicin-5 variants with mutations in either the receptor-binding domain or the pore-forming domain. These variants can help attribute observed effects to specific functional domains.

  • Competition Experiments: Use fragments containing only the receptor-binding domain to compete with full-length Colicin-5, thereby blocking receptor binding without inducing pore formation.

  • Electrophysiological Measurements: Direct measurement of pore formation can be achieved using black lipid membrane (BLM) techniques, allowing real-time monitoring of channel formation independent of receptor binding.

  • Immunofluorescence Microscopy: Using labeled antibodies against different domains of Colicin-5 can help visualize the localization of the protein during different stages of its action.

These methods collectively provide a comprehensive understanding of the sequential steps in Colicin-5 action, from initial receptor recognition to the final pore formation event.

How can Colicin-5 be engineered for targeted bactericidal activity against specific pathogens?

Engineering Colicin-5 for targeted bactericidal activity involves several strategic approaches:

  • Domain Swapping: Exchange the receptor-binding domain of Colicin-5 with those from other colicins that recognize receptors on specific target pathogens. This approach maintains the potent pore-forming activity while redirecting specificity.

  • Site-Directed Mutagenesis: Introduction of specific mutations in the receptor-binding domain can alter receptor specificity. Research has shown that mutations in the regions involved in TonB and TolC interactions can modify the spectrum of susceptible bacteria .

  • Fusion Protein Construction: Creating fusion proteins that combine Colicin-5's pore-forming domain with targeting domains from other proteins (such as antibody fragments or pathogen-specific binding peptides) can redirect activity.

  • Immunity Specificity Modification: Alterations in the region between residues 405 and 424 of Colicin-5 can modify immunity specificity , potentially expanding the range of susceptible strains by overcoming existing immunity mechanisms.

The high-level expression system developed for His-tagged Colicin-5 (producing 60-80 mg/L) provides an efficient platform for generating and testing these engineered variants . Any modified constructs should be evaluated for stability, expression efficiency, and targeted killing activity against the intended pathogens.

What research challenges exist in developing Colicin-5 as a targeted antimicrobial agent?

Developing Colicin-5 as a targeted antimicrobial agent faces several research challenges:

  • Delivery Systems: Developing effective delivery systems to overcome barriers such as the outer membrane of Gram-negative bacteria that lack the specific receptors required for Colicin-5 uptake.

  • Resistance Development: Understanding and addressing potential resistance mechanisms, including receptor modifications, immunity protein expression, or proteolytic degradation of the colicin.

  • Stability and Formulation: Ensuring protein stability during storage and administration while maintaining bactericidal activity.

  • Immunogenicity: Assessing and mitigating potential immunogenic responses to Colicin-5 in therapeutic applications.

  • Specificity Optimization: Balancing the narrow-spectrum activity (which is highly specific to E. coli) with the need to target diverse pathogenic strains . While His-tagged Colicin-5 has shown no toxicity toward other tested Gram-negative bacteria, Gram-positive bacteria, or yeast even at high concentrations (1000 μg/ml) , this extreme specificity may limit its therapeutic scope.

  • Safety Profile Development: Comprehensive evaluation of safety, including absence of cytotoxicity toward mammalian cells. Current research indicates that His-tagged Colicin-5 is not hemolytic to rabbit erythrocytes and has no obvious cytotoxicity to nucleated mammalian cells at high concentrations (500 μg/ml) .

Addressing these challenges requires interdisciplinary approaches combining protein engineering, microbiology, pharmacology, and drug delivery expertise.

How does Colicin-5 compare structurally and functionally with other pore-forming colicins?

Colicin-5 shares structural and functional features with other pore-forming colicins but maintains distinct characteristics:

Structural Comparisons:

  • Sequence Homology: Colicin-5 shows the highest sequence homology with Colicin-10 (93.7% identity), making them the most closely related colicins . This high similarity suggests recent evolutionary divergence.

  • Domain Organization: Like other pore-forming colicins (E1, Ia, Ib, K), Colicin-5 has three functional domains: receptor-binding domain, translocation domain, and pore-forming domain.

  • Molecular Weight: Purified Colicin-5 has an electrophoretic mobility corresponding to approximately 57 kDa in SDS-PAGE, which is indistinguishable from Colicin-10 .

Functional Comparisons:

  • Transport Requirements: Colicin-5 requires the same proteins for import into sensitive cells as Colicin-10, reflecting their structural similarity .

  • Immunity Specificity: Despite high sequence similarity with Colicin-10, Colicin-5 has distinct immunity specificity. The regions determining this specificity have been localized to residues 405-424 in Colicin-5 .

  • Pore Formation Mechanism: Colicin-5 forms transmembrane channels in the cytoplasmic membrane of sensitive cells, similar to other pore-forming colicins, but the exact kinetics and biophysical properties of these channels may differ.

The immunity proteins show less conservation than the colicins themselves. For example, Cfi (Colicin-5 immunity protein) and Cti (Colicin-10 immunity protein) exhibit 65.6% identity, which is the highest among immunity proteins of pore-forming colicins but significantly lower than the 93.7% identity between their cognate colicins .

What methodologies can be used to study the evolutionary relationships between Colicin-5 and other colicins?

To study evolutionary relationships between Colicin-5 and other colicins, researchers can employ several methodological approaches:

These methodologies collectively provide a comprehensive understanding of how Colicin-5 evolved within the broader context of bacteriocin diversity and specialization.

What are the most promising areas for future Colicin-5 research?

The most promising areas for future Colicin-5 research include:

  • Structural Biology: Determination of the complete three-dimensional structure of Colicin-5 in different states (soluble, membrane-bound, and channel-forming) would provide crucial insights into its mechanism of action.

  • Synthetic Biology Applications: Development of engineered Colicin-5 variants with modified target specificity could create new tools for microbiome manipulation or pathogen control.

  • Mechanistic Studies: Further elucidation of the precise mechanism by which the immunity protein inactivates Colicin-5 immediately prior to channel formation would advance understanding of protein-protein interactions in membranes.

  • Therapeutic Development: Investigation of Colicin-5 as a potential narrow-spectrum antibiotic against pathogenic E. coli, capitalizing on its high toxicity to sensitive E. coli cells at low concentrations (0.01 μg/ml) and its lack of toxicity to other microorganisms and mammalian cells .

  • Resistance Mechanisms: Comprehensive investigation of resistance mechanisms that could emerge against Colicin-5 and strategies to overcome them.

  • Delivery Systems: Development of innovative delivery systems for Colicin-5 that could overcome biological barriers and enable targeted delivery to infection sites.

The highly efficient expression vector constructed for His-tagged Colicin-5 provides a valuable tool for these future research directions, facilitating the production of wild-type and modified Colicin-5 variants for comprehensive investigation .

How can advanced techniques in structural biology enhance our understanding of Colicin-5 mechanism of action?

Advanced structural biology techniques can significantly enhance understanding of Colicin-5's mechanism of action:

  • Cryo-Electron Microscopy (Cryo-EM): This technique could capture Colicin-5 in different conformational states during membrane interaction and pore formation, providing visual evidence of structural transitions that occur during the killing process.

  • X-ray Crystallography: Determination of high-resolution crystal structures of Colicin-5 alone and in complex with its immunity protein would reveal the specific molecular contacts that determine immunity specificity and provide insights into the mechanism of inactivation.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Solution NMR could characterize dynamic aspects of Colicin-5 function, particularly the conformational changes that occur during membrane interaction.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique could map regions of Colicin-5 that become protected or exposed during interaction with membranes or the immunity protein, providing information about conformational changes and protein-protein interaction interfaces.

  • Single-Molecule Techniques: Methods such as atomic force microscopy or single-molecule FRET could track individual Colicin-5 molecules during their interaction with membranes, providing insights into the kinetics and dynamics of pore formation.

  • Molecular Dynamics Simulations: Computational approaches based on structural data could simulate how Colicin-5 interacts with membranes and forms pores, generating testable hypotheses about the mechanism of action.

These advanced techniques, when applied in combination, would provide a comprehensive understanding of Colicin-5's structure-function relationships and mechanism of action, potentially guiding rational design efforts for novel antimicrobial applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.