Recombinant Colicin-A immunity protein (cai)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism of Cai Immunity

Cai inhibits colicin A by directly binding to its pore-forming domain, preventing membrane depolarization. Key experimental evidence includes:

  • Co-Immunoprecipitation Studies: Epitope-tagged Cai (EpCai) co-purifies with pfColA fused to a signal peptide (sp-pfColA), confirming interaction .

  • Domain-Specific Recognition: Alkaline phosphatase (AP) fusions to pfColA helices 8 and 9 demonstrated specific co-immunoprecipitation with EpCai, identifying these helices as the binding site .

Recombinant Expression and Localization Studies

Recombinant Cai constructs have elucidated its localization and functional requirements:

ConstructFusion DetailsExpression ControlImmunity Phenotype
E22β-Galactosidase (1,025 aa) fused to Cai (aa 14–178)IPTG-inducible lac promoterNo immunity (aggregation)
VG4β-Galactosidase (12 aa) fused to Cai (aa 13–178)Constitutive expressionImmunity (low expression)
VJ4Colicin A N-terminal (16 aa) fused to Cai (aa 13–178)Mitomycin C-inducible caa promoterInducible immunity
VL1Colicin A epitope (aa 1–178) fused to Cai (aa 13–178)Mitomycin C-inducible caa promoterInducible immunity (epitope-tagged)

Key Findings:

  • NH₂-Terminal Flexibility: The NH₂-terminal region (aa 1–13) is dispensable for function but required for proper topology .

  • Membrane Localization: Epitope-tagged Cai localized to the cytoplasmic membrane via sucrose gradient centrifugation and immunogold labeling .

  • Low-Level Sufficiency: Minimal Cai expression (e.g., VG4) confers immunity, suggesting high efficiency in colicin neutralization .

Research Implications and Applications

  1. Bacteriocin Resistance Mechanisms: Cai’s interaction with pfColA helices 8 and 9 provides a model for understanding pore-forming toxin inhibition .

  2. Biotechnological Tools: Recombinant Cai constructs enable precise control of colicin A sensitivity in E. coli, useful for plasmid selection or synthetic biology .

  3. Structural Constraints: The strict dependence on Cai’s cytoplasmic loop and periplasmic loop integrity highlights conserved features in membrane protein folding .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cai; Colicin-A immunity protein; Microcin-A immunity protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Citrobacter freundii
Target Names
cai
Target Protein Sequence
MMNEHSIDTDNRKANNALYLFIIIGLIPLLCIFVVYYKTPDALLLRKIATSTENLPSITS SYNPLMTKVMDIYCKTAPFLALILYILTFKIRKLINNTDRNTVLRSCLLSPLVYAAIVYL FCFRNFELTTAGRPVRLMATNDATLLLFYIGLYSIIFFTTYITLFTPVTAFKLLKKRQ
Uniprot No.

Target Background

Function
This protein is capable of protecting a cell harboring the plasmid ColA, encoding colicin A, against colicin A.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the cellular localization of Colicin-A immunity protein (Cai)?

Cai is located in the cytoplasmic membrane of Escherichia coli. This localization has been directly demonstrated using epitope tagging techniques, where researchers "tagged" the immunity protein with an epitope from colicin A protein for which a monoclonal antibody was available. This methodology enabled precise tracking of the protein within cellular compartments . The NH₂-terminal region of Cai is directed toward the cytoplasm, while other portions of the protein span the membrane and interact with the colicin A toxin . This membrane localization is critical for its protective function, as it allows the immunity protein to physically intercept the pore-forming domain of colicin A before channel formation can occur.

How does Cai provide immunity against colicin A?

Cai functions through a direct interaction mechanism with the pore-forming domain of colicin A. Specifically, biochemical evidence shows that Cai recognizes and interacts with the hydrophobic helical hairpin of colicin A . Studies using coimmunoprecipitation techniques have demonstrated that Cai specifically binds to the hydrophobic α-helices 8 and 9 of the colicin A pore-forming domain . This interaction occurs via lateral diffusion of the immunity protein in the membrane, allowing rapid recognition of colicin pore-forming domains just prior to channel opening . By binding to these critical structural elements, Cai prevents the conformational changes necessary for pore formation, thereby neutralizing the bactericidal activity of colicin A.

What expression systems are effective for studying recombinant Cai?

Recombinant Cai can be effectively studied using several expression systems:

  • Plasmid-based bacterial expression: Recombinant plasmid constructs allowing expression of various immunity fusion proteins under the control of inducible promoters have been successfully employed . This approach enables controlled expression levels and analysis of structure-function relationships.

  • Plant-based expression: Although not specifically mentioned for Cai, other colicin immunity proteins have been successfully expressed in Nicotiana benthamiana plants, with recombinant protein yields ranging from 0.6 to 3 mg/g fresh weight (7-32% of total soluble protein) .

  • Fusion protein systems: Creating fusion proteins with elements like alkaline phosphatase (AP) has proven effective for studying specific domains and interactions . This methodology allows for precise tracking of protein localization and interaction studies.

The choice of expression system should be guided by experimental objectives, required protein yield, and downstream analytical techniques.

What experimental techniques are recommended for verifying Cai-colicin interactions?

Several established experimental techniques have proven effective for studying Cai-colicin interactions:

  • Coimmunoprecipitation: This approach has provided the first biochemical evidence that Cai physically interacts with colicin A. By using epitope-tagged immunity protein (EpCai) and antibodies directed against the epitope tag, researchers successfully demonstrated specific binding between Cai and the pore-forming domain of colicin A .

  • Fusion protein analysis: Creating fusion proteins where various segments of the colicin A pore-forming domain are fused to reporter proteins like alkaline phosphatase enables mapping of specific interaction sites .

  • Bacterial sensitivity assays: Functional assessment of immunity can be performed by expressing Cai in susceptible bacterial strains and observing changes in sensitivity to colicin A. This approach allows correlation between immunity protein expression levels and resistance to colicin A .

  • Membrane insertion studies: Techniques that analyze the membrane topology of Cai, such as those that determined the NH₂-terminal region faces the cytoplasm, provide important structural insights that relate to function .

What structural elements of Cai are essential for recognition of the colicin A pore-forming domain?

While the complete three-dimensional structure-function relationship of Cai remains to be fully characterized, research indicates several critical elements:

Understanding these structural elements provides insights for protein engineering and the development of novel immunity-based antimicrobial strategies.

How do researchers overcome challenges in detecting low-abundance immunity proteins like Cai?

Detecting naturally expressed Cai presents significant challenges due to its very low constitutive expression levels in E. coli. Researchers have developed several effective strategies to address this limitation:

  • Epitope tagging: By creating fusion proteins where Cai is tagged with an epitope (such as the 30 N-terminal amino acid residues of colicin A), researchers can use specific monoclonal antibodies to detect and track the protein . This approach significantly enhances detection sensitivity.

  • Controlled overexpression: Using recombinant plasmid constructs with inducible promoters allows researchers to control and increase the expression level of Cai . This approach facilitates biochemical and functional studies that would be challenging at natural expression levels.

  • Reporter protein fusions: Fusing Cai or portions of Cai to reporter proteins such as alkaline phosphatase creates hybrid proteins that can be more easily detected while retaining functional domains of interest .

  • Mass spectrometry techniques: Advanced mass spectrometry approaches have been employed to analyze membrane protein fragments, although some studies noted challenges in obtaining peptide fragments assignable to immunity proteins of interest .

These methodologies can be adapted based on specific research objectives and available equipment.

What is known about the cross-reactivity of Cai with other colicin types?

Understanding the specificity and cross-reactivity of immunity proteins provides insights into their evolution and potential applications. While the search results don't directly address Cai cross-reactivity with other colicins, studies of related immunity systems provide valuable insights:

This pattern suggests that Cai may have limited cross-reactivity with closely related colicins but is unlikely to provide protection against structurally divergent toxins. Targeted experimental testing would be required to definitively establish the cross-reactivity profile of Cai.

What experimental approaches can be used to map the precise interaction sites between Cai and colicin A?

Researchers have employed several sophisticated methodologies to map the interaction interfaces between Cai and colicin A:

  • Truncation analysis: By creating a series of fusion proteins with various numbers of colicin A α-helices fused to reporter proteins like alkaline phosphatase, researchers identified that the hydrophobic α-helices 8 and 9 of the colicin A pore-forming domain are specifically recognized by Cai .

  • Site-directed mutagenesis: Systematic mutation of residues in both the immunity protein and the bacteriocin helps identify critical amino acids required for interaction. Similar approaches in related immunity systems have shown that even conserved residues (like the Asp in PmiA proteins) may not always be essential for function .

  • Coimmunoprecipitation of protein fragments: This approach has been particularly valuable, allowing researchers to confirm that fusion proteins made up of the hydrophobic α-helices 8 and 9 of colicin A pore-forming domain fused to alkaline phosphatase could be specifically coimmunoprecipitated with epitope-tagged immunity protein produced in the same cells .

  • Membrane topology analysis: Understanding which portions of Cai are exposed to the periplasm versus the cytoplasm helps predict potential interaction sites with the pore-forming domain of colicin A .

These complementary approaches have established that Cai interacts specifically with the hydrophobic helical hairpin of colicin A, providing the first biochemical evidence of this interaction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.